[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86352.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->142 PF11164 * DUF2948 9e-39 53.6 %
:HMM:PFM   4->142 PF11164 * DUF2948 1.6e-56 54.3 138/138  
:BLT:SWISS 21->93 DYH1B_CHLRE 4e-04 26.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86352.2 GT:GENE AAK86352.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(529302..529742) GB:FROM 529302 GB:TO 529742 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86352.2 GB:DB_XREF GI:159139675 LENGTH 146 SQ:AASEQ MSGLKLLALDTEDLSIISTHMQDSVFKLKDVAFEPRQGQFTLSANRFVWESASKKNLPPERCRSVIFLKRVSAVRSQSINLADREQVLSLLAIRFTPDGEGPDGVVELALSGGGTIALDVECIEAQLTDVSGAWETAAKPHHPDSE GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 21->93|DYH1B_CHLRE|4e-04|26.0|73/4513| RP:PFM:NREP 1 RP:PFM:REP 4->142|PF11164|9e-39|53.6|138/138|DUF2948| HM:PFM:NREP 1 HM:PFM:REP 4->142|PF11164|1.6e-56|54.3|138/138|DUF2948| OP:NHOMO 59 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------1111--11-11111111111111-111111111-1-11111111111111111111-1--111--------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,51-60,136-147| PSIPRED ccccEEEEccHHHHHHHHHHHHcccEEEccEEEcccccEEEEEEEHHHHHHcccccccccEEEEEEEEccHHHHHHcccccccHHHHHEEEEEEEEEccccccEEEEEEEEcccEEEEEEEEEEEEEEcccccccccccccccccc //