[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86379.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:218 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   54->98 PF02317 * Octopine_DH 0.00069 26.7 45/152  
:BLT:SWISS 113->199 AFG2_SCHPO 3e-05 36.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86379.1 GT:GENE AAK86379.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 552787..553443 GB:FROM 552787 GB:TO 553443 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86379.1 GB:DB_XREF GI:15155507 LENGTH 218 SQ:AASEQ MSASIARFLKDFGEAQPASPAFGDGLADADTDFASGFADITSGFDDLTPVDAEGEKQAAYARGYEDATREITEKMQAEREELLAAHAAELEELRSVYLEETAVFLSRRLREGIDAIAANLSEQTANILAPLLTEKLSLKAVSSLADVVRASMPDGEAVTLVVKGPKNLFEQLKTQPGFEEETMKFTETADIDLSIELGESVFVTRMSAWASSLRKVMK GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 113->199|AFG2_SCHPO|3e-05|36.0|86/809| SEG 77->94|aereellaahaaeleelr| HM:PFM:NREP 1 HM:PFM:REP 54->98|PF02317|0.00069|26.7|45/152|Octopine_DH| OP:NHOMO 25 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111---------11--111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 57-65| PSIPRED ccHHHHHHHHHHccccccccEEccccccccccccccHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHccccHHHHccEEEccccEEEEEEccHHHHHHHHHHHHHHHHHHc //