[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86395.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:175 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   86->130 PF10135 * Rod-binding 5e-06 41.9 %
:HMM:PFM   86->127 PF10135 * Rod-binding 4.7e-13 21.4 42/49  
:HMM:PFM   121->138 PF04967 * HTH_10 0.00052 50.0 18/53  
:BLT:SWISS 60->133 CHEL_CAUCR 7e-06 28.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86395.2 GT:GENE AAK86395.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 567999..568526 GB:FROM 567999 GB:TO 568526 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86395.2 GB:DB_XREF GI:159139688 LENGTH 175 SQ:AASEQ MDVVRAADPQEVQVAQEKLKANKAAFAATSLADAGKGFGAAVDMLDGASSKAGLGDTNIRSARTEIPETYRKYEASVLQTFVANMLPKDSEEVYGKGNAGEIWKSMMAEQFADTISRNGGVGIAEQAYKDALRKAESKGITDVSMNDKDHNAAIRMVAEFERQVLGVSNDKTDEA GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 60->133|CHEL_CAUCR|7e-06|28.4|74/111| RP:PFM:NREP 1 RP:PFM:REP 86->130|PF10135|5e-06|41.9|43/49|Rod-binding| HM:PFM:NREP 2 HM:PFM:REP 86->127|PF10135|4.7e-13|21.4|42/49|Rod-binding| HM:PFM:REP 121->138|PF04967|0.00052|50.0|18/53|HTH_10| OP:NHOMO 37 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1------1--111111111111-11111-1111--111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,60-60,62-63,66-66,168-176| PSIPRED cccHHHccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccc //