[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86397.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:177 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->138 PF03748 * FliL 2.8e-09 26.0 131/149  
:BLT:SWISS 57->134 PYRD_GEOUR 2e-04 31.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86397.1 GT:GENE AAK86397.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 568924..569457 GB:FROM 568924 GB:TO 569457 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86397.1 GB:DB_XREF GI:15155527 LENGTH 177 SQ:AASEQ MLKLLLTGVWVCAVTLGAVYFSVQMATAPAPDEAGAKKADLQLVKGESITIPVINDGGVNGYFLSRISLRVDKAKMAKIELPATQLMTDELFTLLAGSSMVNIANISTFDPEAFKQRIREGLNKRLDDEVVEDVLIEQLDYLSKADIREQKGNGSPHSVKLVEGEKAEAGEAAAPSH GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 57->134|PYRD_GEOUR|2e-04|31.2|77/305| TM:NTM 1 TM:REGION 3->25| SEG 163->174|egekaeageaaa| HM:PFM:NREP 1 HM:PFM:REP 4->138|PF03748|2.8e-09|26.0|131/149|FliL| OP:NHOMO 39 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111------1--11-111111111-1111111111-111-1111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 150-177| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEcccEEEEEEEEcccccEEEEEEEEEEEcHHHHccccccHHHHHHHHHHHHHHccccccHHHHHEEcHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHccccccccHHHccccccccccccccc //