[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86407.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:139 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->92 PF09505 * Dimeth_Pyl 5.2e-05 24.6 61/466  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86407.1 GT:GENE AAK86407.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 581170..581589 GB:FROM 581170 GB:TO 581589 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86407.1 GB:DB_XREF GI:15155541 LENGTH 139 SQ:AASEQ MGVQSGAGVIRNHYLSKEESFMYDRESRFRMEDTMNAARIEYTEKAVMHMAARRCDVIRISQTEAVLALLTKYNLPNQFYLDIPDARISKIGCVILRVNANNTIHVRFLRMLTQKELDRIFVFSTHPAHKDRKLDIRSF GT:EXON 1|1-139:0| HM:PFM:NREP 1 HM:PFM:REP 31->92|PF09505|5.2e-05|24.6|61/466|Dimeth_Pyl| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccccccHHHHHHHccccccEEEcccccccHHHcHHHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHcccccEEEEccccHHHHHEEEEEEEccccEEEHHHHHHHHHHcccEEEEEEccccccccEEEEccc //