[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86414.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  566/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
c.3.1e.74.1
:394 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->389 2gqfA PDBj 6e-84 49.1 %
:RPS:PDB   4->394 1d4cB PDBj 8e-23 19.1 %
:RPS:SCOP  29->198 2gqfA1  c.3.1.8 * 2e-52 49.4 %
:RPS:SCOP  193->338 2gqfA2  e.74.1.1 * 2e-40 37.2 %
:RPS:SCOP  326->391 2gqfA1  c.3.1.8 * 1e-22 49.4 %
:HMM:SCOP  1->394 1kf6A2 c.3.1.4 * 1.1e-39 28.2 %
:RPS:PFM   31->392 PF03486 * HI0933_like 4e-99 51.8 %
:HMM:PFM   6->392 PF03486 * HI0933_like 3.5e-147 49.7 386/409  
:BLT:SWISS 29->381 YHIN_ECOLI e-104 55.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86414.2 GT:GENE AAK86414.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 590323..591507 GB:FROM 590323 GB:TO 591507 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86414.2 GB:DB_XREF GI:159139697 LENGTH 394 SQ:AASEQ MMTEKCDVLILGAGAAGMMGAIRAGKRGRSVIILDHARAPGEKIRISGGGRCNFTNIHAGPKNYLSSNPHFAKSALARYTPHDFIALVEKHRIAWHEKTLGQLFCDDSAKDIIRMLLAEMQAVNAKLRLETSVSAVTHDGGRFRVTTSGGVIEAESLVVATGGKSIPKMGATGFAYQIAEQFGLKLIEPRPGLVPLTLDPAALEKLSPLAGVAVPAEVSHGKTSFEEALLFTHRGLSGPSILQISSYWREGDAIRLKLEPARDIVSLLRQAKQKNGRQSAQTALSEILPKRLAQHVVEQTGITGNLADMSEKVLAKLAAQVQDWQIKPAGSEGYRTAEVTLGGVDTTGLDSRSMAAKSVPGLYFIGECVDVTGWLGGYNFQWAWASGQAAGEFA GT:EXON 1|1-394:0| BL:SWS:NREP 1 BL:SWS:REP 29->381|YHIN_ECOLI|e-104|55.0|349/400| SEG 9->28|lilgagaagmmgairagkrg| BL:PDB:NREP 1 BL:PDB:REP 29->389|2gqfA|6e-84|49.1|352/394| RP:PDB:NREP 1 RP:PDB:REP 4->394|1d4cB|8e-23|19.1|383/566| RP:PFM:NREP 1 RP:PFM:REP 31->392|PF03486|4e-99|51.8|361/394|HI0933_like| HM:PFM:NREP 1 HM:PFM:REP 6->392|PF03486|3.5e-147|49.7|386/409|HI0933_like| RP:SCP:NREP 3 RP:SCP:REP 29->198|2gqfA1|2e-52|49.4|170/253|c.3.1.8| RP:SCP:REP 193->338|2gqfA2|2e-40|37.2|145/148|e.74.1.1| RP:SCP:REP 326->391|2gqfA1|1e-22|49.4|66/253|c.3.1.8| HM:SCP:REP 1->394|1kf6A2|1.1e-39|28.2|234/312|c.3.1.4|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 652 OP:NHOMOORG 592 OP:PATTERN --------------------------------11---------11111-------------------- 111---------------------------------------------------------------------------1111-----------------111111111-1--------------111111111111-----222--111-111--11111111111-11111111111111-1-------2111111111111111111111111111111111111111111111111111111111111111----------------------11111111111111111111111111111111111111111111111-222222222222221222233322122-221-2222-1-11-111---11-11111-----1-1111-11111111111-11111-----------1-211111111121--1-11211111121111111111111-22------------------------------11111-111111111111111111111111-11111111112221111111111-21-----1--------111112--1-11111111111-------1-------1-321-----------------32113--11-111111111111111111111111111--1111-------1111-111111111111-111111111111111111111111111111111111111111111111111--111111111111---1-----1111-111111-111111-1111111111111111-111111121111111111-2--111-1111111111111111111111111------1-111-11----------1---------------------------1--------1- ------------------------------------------------------------------------------------------------------------21-----------------------------------------------------------------111-1111111--1-11111---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 394 STR:RPRED 100.0 SQ:SECSTR EccEEccEEEEcccHHHHHHHHHHHHHTccEEEEcccccccTTGGGccccEEccccHHHHHHTTccccHHHHHHHHHHHTTTHHHHHHHHHHHHHHHHTTccccEEEccTTHHHHHHHHHHHTTcEEEccEEEEEEEEccccEETTTEEEEEEccEEEEccccEEcccTTcccHHHHHHHTTTccEEcTTcEEEEEEcTTTcccccTHHHHTTcEEEcccccccccTTccHHHHHHHHHTcTTccEEEEEEHHHHHHcTHHHHHHHTTTccEEETccEEEccHHHHHHHHTccHHHHHHHHHHHHHHHHHTccccccccccccccccEEEEEEEEEEEEEccEccTTcEEEcTTTccEEEEEEEccTTEcTTcccTTHHHHHHHHHHHHHHHHH DISOP:02AL 1-3,272-280,394-395| PSIPRED cccccEEEEEEcccHHHHHHHHHHHHcccEEEEEcccccccccEEcccccccccccccccHHHHHcccHHHHHHHHHHccHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHHHHcccEEEEccEEEEEEEEccEEEEEEccEEEEEcEEEEEccccccccccccHHHHHHHHHcccEEEcccccEEEEEccHHHHHcccccccccEEEEEEcccEEEEccEEEEccccHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHcccHHHHHHHHHHHHccEEEEcccccHHHHHHHcccccHHHccHHHHHHHccccEEEEEEEEEccccccHHHHHHHHHHHHHHHccc //