[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86415.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->38 PF00771 * FHIPEP 0.00016 36.7 30/658  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86415.2 GT:GENE AAK86415.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(591618..591965) GB:FROM 591618 GB:TO 591965 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86415.2 GB:DB_XREF GI:159139698 LENGTH 115 SQ:AASEQ MHAIFAAQAIIDNQKPRTRREAILQEEKFYADMAEASRAWRLFSALAGLINVTSRRSIKESDQGCDGTGCDDAEVEGQLPALAFGAGDGNGARAAMCRSVHARAPDEKLNRPMPC GT:EXON 1|1-115:0| HM:PFM:NREP 1 HM:PFM:REP 9->38|PF00771|0.00016|36.7|30/658|FHIPEP| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,59-64,115-116| PSIPRED ccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccccccEEEcccccccHHHHHHHHHHHcccHHHHcccccc //