[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86423.1
DDBJ      :             ABC transporter, membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  646/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:270 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->200 2onkC PDBj 1e-12 25.3 %
:RPS:PDB   156->197 3dhwA PDBj 1e-09 23.7 %
:RPS:SCOP  29->246 2r6gG1  f.58.1.1 * 5e-25 21.2 %
:RPS:PFM   83->215 PF00528 * BPD_transp_1 1e-08 35.9 %
:HMM:PFM   74->247 PF00528 * BPD_transp_1 4.1e-22 23.4 167/185  
:BLT:SWISS 3->269 POTI_ECOLI 4e-62 47.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86423.1 GT:GENE AAK86423.1 GT:PRODUCT ABC transporter, membrane spanning protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 599651..600463 GB:FROM 599651 GB:TO 600463 GB:DIRECTION + GB:PRODUCT ABC transporter, membrane spanning protein GB:PROTEIN_ID AAK86423.1 GB:DB_XREF GI:15155559 LENGTH 270 SQ:AASEQ MKRGKFDITVLTLGFAFLYIPIIILIIYSFNASKLVTVWGGFSLQWYKSMWSNQGLMDAAWVTLRVGILSATIGTILGTLAALSLTRFARFPGRVLFSGMIYAPLVMPEVITGLSLLLLFVAVGVDRGFWTVVIAHTTFTMCYVAIVVQSRLLTFDRSLEEAALDLGCPPVKTFFRITLPLIFPAVIAGWMLAFTLSLDDLVIASFATGPGATTLPIKIYSQVRLGVTPEINAICTILIGLVTIGVIAASVASKRTELQRMRDEHAAARN GT:EXON 1|1-270:0| BL:SWS:NREP 1 BL:SWS:REP 3->269|POTI_ECOLI|4e-62|47.2|267/281| TM:NTM 6 TM:REGION 8->30| TM:REGION 60->82| TM:REGION 98->120| TM:REGION 130->151| TM:REGION 181->203| TM:REGION 232->253| SEG 18->28|lyipiiiliiy| BL:PDB:NREP 1 BL:PDB:REP 42->200|2onkC|1e-12|25.3|158/252| RP:PDB:NREP 1 RP:PDB:REP 156->197|3dhwA|1e-09|23.7|38/203| RP:PFM:NREP 1 RP:PFM:REP 83->215|PF00528|1e-08|35.9|131/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 74->247|PF00528|4.1e-22|23.4|167/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 29->246|2r6gG1|5e-25|21.2|217/284|f.58.1.1| OP:NHOMO 2035 OP:NHOMOORG 687 OP:PATTERN 22--31----------3-111112311-2-111--1--2322211-1---1---1322112-1----- -11-2---11-1--2--11-12--161111112232132311-3-111211-2111------4-3-12141------11-1-3-----1112-1-----------1-1----------------1------12---11133--143--21--12533------11135453------------31211-1--1-111-1431211142122221111313231111111117411111111111111-122122112111-11122111111-11211111111111111111111111111111111111111111111111--1142222222121111112213-31242221321-2351-----1121---2112-----11DCD325335326666666566C-437335248O1-HGGI88CJEEJLF6---24HB8CFD66111111111----326-----------------------------1---1-2553267776812443AADD88673686E3142--33342-1113A65D213-1--231122222211--1116---51--322311----------1-23-21--------------------------324-412---112222111222312113111--1--2------46432545445565655-5555665555565555445868663245466656665565665544444543-455545555555---1-----11111-429222433222112111------2-212165555687557563777111111111-1221333333223311112113331------222111111111111-1211111--11--11----111--1111112232243-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------2----1------------12------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 200 STR:RPRED 74.1 SQ:SECSTR #########################################TTHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHcTTcTTTTTcTTcHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHcHHHHHcTTccHHHHHHHHHHHcTTTTTHH#####HHHHHHHHHHHH######################## DISOP:02AL 1-3, 258-264, 266-270| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccEEHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //