[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86432.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.56.1
:139 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  56->129 2h8aA1  f.56.1.1 * 3e-11 24.3 %
:HMM:PFM   9->133 PF01124 * MAPEG 1.4e-19 18.8 117/123  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86432.1 GT:GENE AAK86432.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 613968..614387 GB:FROM 613968 GB:TO 614387 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID AAK86432.1 GB:DB_XREF GI:15155572 LENGTH 139 SQ:AASEQ MSPTTAMFWPMIAHAFLVFILYALLLHRRKNHTLTSREAVTQYRERGEEGQASYLVNRNIANQFELPVLFHAICLLLYITDADNVVTVVLAWLFVISRYAHSYVHVTSNRLRYRAPLFGIGFALLVCLWGWLAIWLALE GT:EXON 1|1-139:0| TM:NTM 3 TM:REGION 6->27| TM:REGION 81->103| TM:REGION 115->137| HM:PFM:NREP 1 HM:PFM:REP 9->133|PF01124|1.4e-19|18.8|117/123|MAPEG| RP:SCP:NREP 1 RP:SCP:REP 56->129|2h8aA1|3e-11|24.3|74/121|f.56.1.1| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1----------------------------1--11--111111111---1-------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------1-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 41-51| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //