[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86437.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->37 PF12338 * RbcS 0.00043 30.6 36/45  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86437.2 GT:GENE AAK86437.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 618896..619165 GB:FROM 618896 GB:TO 619165 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86437.2 GB:DB_XREF GI:159139709 LENGTH 89 SQ:AASEQ MIKNIAIAAFALVAATSVASANGLLSDSAPPVAKITENHGKPGDTAVSVSNPEVTYRVLKNGMVERTNSRFDTTTYVDPTAVLRDRNRR GT:EXON 1|1-89:0| TM:NTM 1 TM:REGION 1->23| SEG 5->21|iaiaafalvaatsvasa| HM:PFM:NREP 1 HM:PFM:REP 2->37|PF12338|0.00043|30.6|36/45|RbcS| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,86-90| PSIPRED cccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcccccccEEEEcccHHHHHHHHccccHHccccccccccccHHHHHHHcccc //