[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86442.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:98 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->97 2hfvA PDBj 5e-20 60.0 %
:RPS:SCOP  23->97 2hfvA1  d.58.5.5 * 1e-24 60.0 %
:RPS:PFM   25->89 PF09413 * DUF2007 6e-16 64.6 %
:HMM:PFM   24->90 PF09413 * DUF2007 3.3e-34 62.7 67/68  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86442.1 GT:GENE AAK86442.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 623826..624122 GB:FROM 623826 GB:TO 624122 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86442.1 GB:DB_XREF GI:15155582 LENGTH 98 SQ:AASEQ MPCAARGELPLAIQKDGNLGLSMRELIRTNDAVLLSFAESLMKDAGIHCLIADQAMSILEGSLGLLPRRFLVEEDRAGEARRILVDAGLGDELRNEEA GT:EXON 1|1-98:0| BL:PDB:NREP 1 BL:PDB:REP 23->97|2hfvA|5e-20|60.0|75/97| RP:PFM:NREP 1 RP:PFM:REP 25->89|PF09413|6e-16|64.6|65/68|DUF2007| HM:PFM:NREP 1 HM:PFM:REP 24->90|PF09413|3.3e-34|62.7|67/68|DUF2007| RP:SCP:NREP 1 RP:SCP:REP 23->97|2hfvA1|1e-24|60.0|75/75|d.58.5.5| OP:NHOMO 55 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111111111111111111-111111111-1--11111111111111--1-11-11111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 75 STR:RPRED 76.5 SQ:SECSTR ######################EEEEEEEccHHHHHHHHHHHHHTTccEEcccccccccccccccccEEEEEEGGGHHHHHHHHHHTTccccccccc# DISOP:02AL 1-6, 95-98| PSIPRED ccccccccccEEEEcccccccHHHHHHccccHHHHHHHHHHHccccccEEEEcccEEEEcccccccccEEEcccccHHHHHHHHHHccHHHHHccccc //