[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86454.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:169 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86454.2 GT:GENE AAK86454.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(636820..637329) GB:FROM 636820 GB:TO 637329 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86454.2 GB:DB_XREF GI:159140665 LENGTH 169 SQ:AASEQ MQRLFLTAIVVLTSGSAMASSIEYINDVQVTNGSFVRLNCAGCQPLKNKPAAQGYAVPSIEPGTQHTEMHEVDGKRTLVRTEAWLGGAPVTFVSTNPAWMTDPSGTVIATYDDAAPEAHPAETASTPAGIDVTATTAAVNAISSDNASKPANASVIDTPQFPDFQLRGN GT:EXON 1|1-169:0| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--11111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,141-152,169-170| PSIPRED ccHHHHHHHHHHHccHHHHHHHcccccEEEEcccEEEEEcccccccccccccccEEccccccccccEEEEEEcccEEEEEEEEccccccEEEEEccHHHcccccccccHHHHcccccccccHHHcccccccEEccHHHHHHHHcccccccccHHHHcccccccEEEccc //