[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86458.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:266 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   35->261 PF06629 * MipA 2e-12 30.7 %
:HMM:PFM   32->261 PF06629 * MipA 3.1e-56 32.7 223/226  
:BLT:SWISS 35->244 Y351_CAUCR 3e-09 22.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86458.2 GT:GENE AAK86458.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 642860..643660 GB:FROM 642860 GB:TO 643660 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86458.2 GB:DB_XREF GI:159139720 LENGTH 266 SQ:AASEQ MFKPSAAVAACVLSLFAVGNAHAEGWFSGDWYLKLGGAGFTAPKYQGDNKNEFGFSPIISLGRQGQGARFTSRNDSASISLLDNGPISMGLAGKLVSPRDEGDSADLKGMTRIKRGGELGGFAEAYPTDWLRIRGEARQGIRSHSGVVADLNADVFTDIAPGIQVSVGPRATWVSSKYNERYYGVSAAQTAAGAPSPYSPGGGLHSAGVGAAITWKVTENAEVGSFAEYRRLMGDAADSSLVRERGSKNQFIVGVQASYKFNFSLP GT:EXON 1|1-266:0| BL:SWS:NREP 1 BL:SWS:REP 35->244|Y351_CAUCR|3e-09|22.0|205/254| SEG 191->203|aagapspyspggg| RP:PFM:NREP 1 RP:PFM:REP 35->261|PF06629|2e-12|30.7|218/224|MipA| HM:PFM:NREP 1 HM:PFM:REP 32->261|PF06629|3.1e-56|32.7|223/226|MipA| OP:NHOMO 39 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------1-------------1---1----111--221111-1111122-1--11---------------1-------------------------------------11----------------------1---------111----1-------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,102-104,106-106| PSIPRED cccHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEEEEEEEccccccEEEEEEEEEEEEccccEEEEEcccEEEEEEEccccEEEEEEEEccccccccccHHHHccccccccEEEEEEEEEEEEccEEEEEEEEEEEcccccEEEEEEEEEEcccccEEEEEEEEEEEEccccccEEEccccHHHHcccccccccccccEEEEEEEEEEEEEccccEEEEEEEEEEEEcccccccccEEEEcccccEEEEEEEEEEEEEEcc //