[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86460.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:188 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86460.1 GT:GENE AAK86460.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(644810..645376) GB:FROM 644810 GB:TO 645376 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86460.1 GB:DB_XREF GI:15155604 LENGTH 188 SQ:AASEQ MTKTVLKPDWAVATLRLDPARFPQQVTYGKANGATDVAVTLDERGAVLRKVLTSSGLPLSFALPARAFKGVAARAIDHGDGQVTVTLELHHDDPDLCVPLLVAHDLYDIAADWRSWSEAYRIPMLMVEADGVARPLEEHLGKVRTQNTRPRRRHSYFADRRPRFLVRRSTGSLGMSMKIEGKEIIARS GT:EXON 1|1-188:0| OP:NHOMO 32 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111---------1---11111111111------1--11--111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 147-157, 187-188| PSIPRED cccccccccccEEEEEEccccccEEEEEEEEccccEEEEEEcccEEEEEEEcccccccEEEEEcHHHcccEEEEEcccccHHHHHHHHHHHccccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHcccccccccHHHHHcccccccccEEEEEEccccEEEEEEEcccEEEEcc //