[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86463.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   38->66 PF06568 * DUF1127 3.4e-10 51.7 29/40  
:BLT:SWISS 49->91 TIG_ERYLH 8e-04 41.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86463.2 GT:GENE AAK86463.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 649376..649669 GB:FROM 649376 GB:TO 649669 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86463.2 GB:DB_XREF GI:159140676 LENGTH 97 SQ:AASEQ MRTAERRMELELVTARPGDAWRRAAVLGVSGVKTFVQRIYNRIVANGLTELDDRLLADIGLVRSDVSDALNTGLLEDPTSHLTRAARKRAVTRFKTL GT:EXON 1|1-97:0| BL:SWS:NREP 1 BL:SWS:REP 49->91|TIG_ERYLH|8e-04|41.9|43/533| HM:PFM:NREP 1 HM:PFM:REP 38->66|PF06568|3.4e-10|51.7|29/40|DUF1127| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccHHHHHHccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcc //