[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86486.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->115 2qqzB PDBj 9e-31 52.7 %
:RPS:PDB   1->118 1bylA PDBj 5e-12 17.2 %
:RPS:SCOP  3->122 1mpyA1  d.32.1.3 * 1e-12 22.0 %
:HMM:SCOP  1->122 1q0oA2 d.32.1.3 * 1.9e-20 34.2 %
:HMM:PFM   6->116 PF00903 * Glyoxalase 1.2e-07 27.5 109/128  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86486.1 GT:GENE AAK86486.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 672422..672790 GB:FROM 672422 GB:TO 672790 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86486.1 GB:DB_XREF GI:15155636 LENGTH 122 SQ:AASEQ MAILALDHVQLAMPAGREEEARRFYGDLLGFAEQAKPANLAMRGGCWFICGLMKLHLGVEQDFRPARKAHPAFLVDDLVSLRKTLETAGCHVVEDEPLEGYHRFYVHDPFGNRIEMMQPLEP GT:EXON 1|1-122:0| BL:PDB:NREP 1 BL:PDB:REP 3->115|2qqzB|9e-31|52.7|112/119| RP:PDB:NREP 1 RP:PDB:REP 1->118|1bylA|5e-12|17.2|116/122| HM:PFM:NREP 1 HM:PFM:REP 6->116|PF00903|1.2e-07|27.5|109/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 3->122|1mpyA1|1e-12|22.0|118/145|d.32.1.3| HM:SCP:REP 1->122|1q0oA2|1.9e-20|34.2|117/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 58 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- ---11-----------------------------------------11-------1-----1-----11--------------------------------------1-------------------------------11---11-----------------------1-------------111------2-111111111111111------1112111111------11-------------------1--------------------------------------------------------------------------------------------------1-------------------------11-----------------------------1--------------11---1-------------------1-------------------------------------------------1-----------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 100.0 SQ:SECSTR cccccccccEEEEEEccHHHHHHHHHHTTccEEEEEcccEEEEEETTEEEEEEEcccTTTGGGcEEEEEEccHHHHHHTTcccccccccccEEccEEETTEEEEEEEcTTccEEEEEEEcTT DISOP:02AL 120-122| PSIPRED ccccEEEEEEEEEcHHHHHHHHHHHHHHcccEEcccccccccccEEEEEEccEEEEEEccccccccccccEEEEEccHHHHHHHHHHccccEEEccccccccEEEEEcccccEEEEEccccc //