[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86490.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86490.2 GT:GENE AAK86490.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(675290..675724) GB:FROM 675290 GB:TO 675724 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86490.2 GB:DB_XREF GI:159139731 LENGTH 144 SQ:AASEQ MRGRDLFEISRRNDALPAAVTTTPDPRTLSHFFISEEWSSELSSGVIRLGEHTSFMHGLPPGECGLLSLVRCYDRGDHARVLELFEQVSTEPSRFCFSTSVSILPAMRQPVICMGESSGFEDGQQGRISGLFLFPRFEDIRFAA GT:EXON 1|1-144:0| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccEEEEccccccccEEEcccccccEEEEEcccccccccccccEEEEcccHHHHHccccccccHHHHHEHHccccHHHHHHHHHHHHcccccEEEEEEEcccccccccEEEEEcccccccccccEEEEEEEcccccccEEcc //