[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86499.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  807/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->184 2fpoF PDBj 2e-17 37.0 %
:RPS:PDB   1->143 3a25A PDBj 3e-10 20.3 %
:RPS:SCOP  29->181 2esrA1  c.66.1.46 * 2e-34 29.1 %
:HMM:SCOP  1->183 1ws6A1 c.66.1.46 * 5.3e-39 41.2 %
:RPS:PFM   1->181 PF03602 * Cons_hypoth95 8e-35 45.2 %
:HMM:PFM   1->182 PF03602 * Cons_hypoth95 7e-51 41.3 179/183  
:BLT:SWISS 1->125 YLBH_BACSU 1e-18 38.8 %
:PROS 119->125|PS00092|N6_MTASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86499.1 GT:GENE AAK86499.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 687122..687679 GB:FROM 687122 GB:TO 687679 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86499.1 GB:DB_XREF GI:15155651 LENGTH 185 SQ:AASEQ MRIVGGEFRGRTLAAPKSNSIRPTIDRTRESLFNILSHAYPESLDGTRVLDVFAGTGAVGLEALSRGCRVALFVENGVEGRGLLWENIDALGLHGRARILRRDATKLGGVNNIEPFDLLFADPPYGHGHGEKAFAAAHAGGWLTSGALAILEERGDVTVTVEPVFKLLESRIFGDTKMHFYRYEP GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 1->125|YLBH_BACSU|1e-18|38.8|121/184| PROS 119->125|PS00092|N6_MTASE|PDOC00087| BL:PDB:NREP 1 BL:PDB:REP 21->184|2fpoF|2e-17|37.0|154/175| RP:PDB:NREP 1 RP:PDB:REP 1->143|3a25A|3e-10|20.3|138/264| RP:PFM:NREP 1 RP:PFM:REP 1->181|PF03602|8e-35|45.2|177/182|Cons_hypoth95| HM:PFM:NREP 1 HM:PFM:REP 1->182|PF03602|7e-51|41.3|179/183|Cons_hypoth95| RP:SCP:NREP 1 RP:SCP:REP 29->181|2esrA1|2e-34|29.1|148/152|c.66.1.46| HM:SCP:REP 1->183|1ws6A1|5.3e-39|41.2|170/0|c.66.1.46|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 828 OP:NHOMOORG 823 OP:PATTERN -------------------------------------------------------------------- 111-1-1-------11111-11111111111-111111111111-1111---111--111111-1111111111111111111--1111111-111---111-11---111111111111111111111111111111111---111--111111111111111-1-111111--1--11--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111-11211111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111-1111--------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121----------1-11-1-1111---11111-11111111111111111111111111--11111---11111111111111111111-11111111111111111111111111111111111111111111111111111-111111111111-1111111111-1111111111111111111111111111111111111111-111111111111111111---11111111111111111111111111111------1111-111-11-1--1-11-11--1111---1----11-1-111-1111 11------1---------------------------------------------------------------------------------------------------1------------------------------------------------------------------11------111122-111-1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 99.5 SQ:SECSTR ccEEEccEEEccEEEEEETTEEEEEETTTccccGGGHHHHHHccTTcEEEETTcTTTTTHHHHHHHTccEEEEEcccHHHHHHHHHHHHHTTcTTTEEEEcccGGGccccccccEEEEEEcccccGGGGHHHHHHHEEEEEEEHHHHHHHEEEEEEEEEEEEETTcHHHHHHHHHHTTcccccc# DISOP:02AL 185-186| PSIPRED cEEEEEEEccEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEccHHHHHHHccccccEEEEEccccccccHHHHHHHHHHcccccccEEEEEEcccccccccccccEEEEEEEcccEEEEEEEEcc //