[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86500.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.19.1
:308 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  27->278 1oxwA_ c.19.1.3 * 9.6e-43 32.5 %
:HMM:PFM   33->203 PF01734 * Patatin 3.1e-24 29.8 171/204  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86500.2 GT:GENE AAK86500.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 687766..688692 GB:FROM 687766 GB:TO 688692 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86500.2 GB:DB_XREF GI:159139733 LENGTH 308 SQ:AASEQ MEQAGNDSVTIVRAGEDVLKGAGGSGHEPTFGLALGGGGARGICHINIVEALDELGIRPVMLSGSSIGSIIGAGMAAGMSGREIREYTLELMGRKGSVAHRLWSLGPASMRHAAHGFRLGQFNLELILHALMPQALPKDFSQLAIPLKVITTDYYAQTEVVVESGEIIQALAASAAIPALFMPVRIDGRIMIDGGIFNPVPYEHLLEHADIVIGVDVVGGPEGDGSTMPNRLDSLFGASQLMMQAAIALKLRLRPPHIFLRPPVHRFGVLDFLKSEEVLNASASIKDDLKRQIEMQVELFHRGQGVEA GT:EXON 1|1-308:0| SEG 32->42|glalggggarg| SEG 63->81|sgssigsiigagmaagmsg| SEG 167->179|iiqalaasaaipa| SEG 185->196|ridgrimidggi| SEG 210->225|divigvdvvggpegdg| HM:PFM:NREP 1 HM:PFM:REP 33->203|PF01734|3.1e-24|29.8|171/204|Patatin| HM:SCP:REP 27->278|1oxwA_|9.6e-43|32.5|237/0|c.19.1.3|1/1|FabD/lysophospholipase-like| OP:NHOMO 30 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111---------11--111111111111-----1----------------------------------------------------------------------------------------------------------------------------------------1-------------------------1--------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-10,15-30,303-309| PSIPRED ccccccccccccccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHcccEEEEEEEcccccEEEEcccHHHHHHHHHcccccccccEEEccEEEEEcccccccHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //