[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86504.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  68/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->78 PF00199 * Catalase 0.00022 26.1 46/384  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86504.1 GT:GENE AAK86504.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 692997..693236 GB:FROM 692997 GB:TO 693236 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86504.1 GB:DB_XREF GI:15155658 LENGTH 79 SQ:AASEQ MTETGKPKQLLHLVFGGELENLQDVQFRDLNALDIVGIYPDYASALTAWKSKAQMTVDNAHMRYFIVHMHRLLNPDDKI GT:EXON 1|1-79:0| HM:PFM:NREP 1 HM:PFM:REP 33->78|PF00199|0.00022|26.1|46/384|Catalase| OP:NHOMO 68 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111-11-1-1111-111111111-1-11111------------------------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 76-79| PSIPRED ccccccccEEEEEEEccEEccccccEEEEcccEEEEEEcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccc //