[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86508.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  63/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   23->63 PF09866 * DUF2093 2e-13 75.6 %
:HMM:PFM   23->63 PF09866 * DUF2093 5e-27 70.7 41/42  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86508.2 GT:GENE AAK86508.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(696752..696985) GB:FROM 696752 GB:TO 696985 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86508.2 GB:DB_XREF GI:159139735 LENGTH 77 SQ:AASEQ MNRFEGGGNRLAVIEYLDGDFRIVQTGSHVLCAVTGKTIPLDELRYWSVARQEAYVDAAASLEAERKAGDLPASVGL GT:EXON 1|1-77:0| RP:PFM:NREP 1 RP:PFM:REP 23->63|PF09866|2e-13|75.6|41/42|DUF2093| HM:PFM:NREP 1 HM:PFM:REP 23->63|PF09866|5e-27|70.7|41/42|DUF2093| OP:NHOMO 64 OP:NHOMOORG 63 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111----111111111111111111111111-11111111111111111111111111111-------------------------------------------------------111211------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12| PSIPRED ccccccccccEEEEEEEcccEEEEccccEEEEEEccccccHHHHHcccHHHHcccccHHHHHHHHHHcccccccccc //