[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86538.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   119->147 PF07886 * BA14K 3e-05 65.5 %
:HMM:PFM   119->147 PF07886 * BA14K 1.1e-18 62.1 29/31  
:BLT:SWISS 4->153 14KL_OCHA4 8e-22 59.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86538.1 GT:GENE AAK86538.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 728682..729143 GB:FROM 728682 GB:TO 729143 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86538.1 GB:DB_XREF GI:15155698 LENGTH 153 SQ:AASEQ MLNFRTTSVATAIIVFFTSFTPSQAFQAPVPITKPAVATENVVPVQYREWDRRRNWDGRHMRRPPPHRDGFYNGHRGYRDRRAGYRYHNGYWFPLAAFATGAIIGGAMQQPRPAYGGSHVSWCQNRWRSYRAYDNTYQPNSGPRRICVSPYSR GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 4->153|14KL_OCHA4|8e-22|59.6|141/151| SEG 74->87|ghrgyrdrragyry| SEG 96->107|aafatgaiigga| RP:PFM:NREP 1 RP:PFM:REP 119->147|PF07886|3e-05|65.5|29/31|BA14K| HM:PFM:NREP 1 HM:PFM:REP 119->147|PF07886|1.1e-18|62.1|29/31|BA14K| OP:NHOMO 58 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------33323333333---------12--211121223233------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 150-153| PSIPRED ccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHcccccHHHHHHcccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccc //