[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86539.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:174 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   141->169 PF07886 * BA14K 2e-08 69.0 %
:HMM:PFM   140->170 PF07886 * BA14K 1.7e-17 54.8 31/31  
:HMM:PFM   39->91 PF07172 * GRP 0.0002 21.3 47/95  
:BLT:SWISS 137->173 14KL_OCHA4 5e-15 75.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86539.2 GT:GENE AAK86539.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 729366..729890 GB:FROM 729366 GB:TO 729890 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86539.2 GB:DB_XREF GI:159139755 LENGTH 174 SQ:AASEQ MKSYIKNIMAVGLSAIVVAGAIVPAEAAMPLPAAPKSVETAGNDASNNVVNVQYWRDRGGRGDWGDRRGWYGGHRGYRDYRPGYRHHDGYWFPLAAFATGAIIGGALSQPREVYRPVPEYRPRPVYREYRPVRRGGMSQAHVNWCYGRYRSYDAYSNTFQPYNGPRQQCYSPYG GT:EXON 1|1-174:0| BL:SWS:NREP 1 BL:SWS:REP 137->173|14KL_OCHA4|5e-15|75.7|37/151| TM:NTM 1 TM:REGION 6->28| SEG 24->35|paeaamplpaap| SEG 54->88|ywrdrggrgdwgdrrgwygghrgyrdyrpgyrhhd| SEG 95->106|aafatgaiigga| SEG 110->134|prevyrpvpeyrprpvyreyrpvrr| RP:PFM:NREP 1 RP:PFM:REP 141->169|PF07886|2e-08|69.0|29/31|BA14K| HM:PFM:NREP 2 HM:PFM:REP 140->170|PF07886|1.7e-17|54.8|31/31|BA14K| HM:PFM:REP 39->91|PF07172|0.0002|21.3|47/95|GRP| OP:NHOMO 59 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------33323333333---------12--111222322233------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,172-175| PSIPRED cHHHHHHHHHHHHHHHHHHHHHcHHHccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccc //