[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86543.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:118 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86543.1 GT:GENE AAK86543.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 733758..734114 GB:FROM 733758 GB:TO 734114 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86543.1 GB:DB_XREF GI:15155703 LENGTH 118 SQ:AASEQ MLNHAPSTLWKATRMRQFGFALFVLISVTTVTQAAAITPLPATGNDVILAQSSDEDSPNFYSRNNRDRQRRAQFICVITPPDSANRRRPYICPLERGRVGGSCRCSGVVGSGTVDTAW GT:EXON 1|1-118:0| SEG 96->112|rgrvggscrcsgvvgsg| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 54-66| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccccccccccccccccEEEEEcccccccccccEEcccccccccccEEEccEEccccccccc //