[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86548.1
DDBJ      :             transcriptional regulator, AsnC family
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  415/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.58.4
:150 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->148 2gqqC PDBj 4e-15 30.4 %
:RPS:PDB   1->150 2e1cA PDBj 1e-22 29.5 %
:RPS:SCOP  1->60 1i1gA1  a.4.5.32 * 6e-16 30.0 %
:RPS:SCOP  69->148 2cg4A2  d.58.4.2 * 4e-12 13.8 %
:HMM:SCOP  1->61 2cg4A1 a.4.5.32 * 1.2e-15 42.6 %
:HMM:SCOP  63->150 1ri7A2 d.58.4.2 * 1.9e-14 31.4 %
:RPS:PFM   92->141 PF01037 * AsnC_trans_reg 8e-04 36.0 %
:HMM:PFM   69->141 PF01037 * AsnC_trans_reg 2.8e-15 29.6 71/74  
:HMM:PFM   22->49 PF01726 * LexA_DNA_bind 0.00018 35.7 28/65  
:BLT:SWISS 1->150 Y224_HAEIN 5e-19 30.0 %
:PROS 19->45|PS00519|HTH_ASNC_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86548.1 GT:GENE AAK86548.1 GT:PRODUCT transcriptional regulator, AsnC family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 739774..740226 GB:FROM 739774 GB:TO 740226 GB:DIRECTION + GB:PRODUCT transcriptional regulator, AsnC family GB:PROTEIN_ID AAK86548.1 GB:DB_XREF GI:15155710 LENGTH 150 SQ:AASEQ MDGIDRKLLNILQGDASRTNVDMADEVGLSPSSCLRRLQRLCASGVIDRIVAILNPAKAGRVLKALVTVELKLHGEQHMRRFLDIASAEEAVSHAYAVTGATDVVLMLRLRDMEEFDALCDRLFRDQHNVARFFTMVVIKTAKEETAIRL GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 1->150|Y224_HAEIN|5e-19|30.0|150/168| PROS 19->45|PS00519|HTH_ASNC_1|PDOC00520| BL:PDB:NREP 1 BL:PDB:REP 1->148|2gqqC|4e-15|30.4|148/157| RP:PDB:NREP 1 RP:PDB:REP 1->150|2e1cA|1e-22|29.5|146/147| RP:PFM:NREP 1 RP:PFM:REP 92->141|PF01037|8e-04|36.0|50/74|AsnC_trans_reg| HM:PFM:NREP 2 HM:PFM:REP 69->141|PF01037|2.8e-15|29.6|71/74|AsnC_trans_reg| HM:PFM:REP 22->49|PF01726|0.00018|35.7|28/65|LexA_DNA_bind| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01037|IPR019887| GO:PFM GO:0005622|"GO:intracellular"|PF01037|IPR019887| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01037|IPR019887| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01037|IPR019887| RP:SCP:NREP 2 RP:SCP:REP 1->60|1i1gA1|6e-16|30.0|60/60|a.4.5.32| RP:SCP:REP 69->148|2cg4A2|4e-12|13.8|80/86|d.58.4.2| HM:SCP:REP 1->61|2cg4A1|1.2e-15|42.6|61/0|a.4.5.32|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 63->150|1ri7A2|1.9e-14|31.4|86/0|d.58.4.2|1/1|Dimeric alpha+beta barrel| OP:NHOMO 1647 OP:NHOMOORG 442 OP:PATTERN ------111111111-1-111----11------1--------------------2-111-1---2--- -1--5---222---1--11-11--1-11111211111242----21---11-333-22----2-3-4331------------------11---1--1--111-1132314-------------------------------------------------------------------------211-------1--------1-------1---1------11--------11---------------------------------------------------------------------------------------------------------11----------------11---------------2--5883111-1328582225447377777675769-113116155F1-EAAAEEPDEGAB5353346A46347AD1111111135531146------------------------------15E6589999IFFGHHD999ACDCBBCCC8BDGE5676-155434766647371222----421111111---131--1-1-1---1----1-1----------1----------------------------11224211627421233212411112143122--1----------23562232222222222-2222222222222222222434343233233323333233333422222221-322222222222---2-----2222-143B----31-1222---189777641212244545737468552667---------1333432332547334311111111--------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------1--1--------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHHHcTTccHHHHHHHHTccHHHHHHHHHHHHHTTccccccccccGGGGTccEEEEEEEEEcTTcHHHHHHHHTcHHTcTTEEEEEEccccccEEEEEEEccHHHHHHHHHHHHHcTTTEEEEEEEEccccccccccccc PSIPRED ccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEEcHHHccccEEEEEEEEEccccHHHHHHHHHHHHccccEEEEEEEEccccEEEEEEEccHHHHHHHHHHHHHccccccEEEEEEEEEEEEccccccc //