[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86553.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:120 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->118 3dxoB PDBj 3e-55 100.0 %
:RPS:PDB   7->117 3dxoA PDBj 2e-07 74.3 %
:RPS:SCOP  2->117 3dxoA1  d.17.4.19 * 3e-46 87.9 %
:HMM:SCOP  1->116 2a15A1 d.17.4.3 * 9.3e-08 25.0 %
:HMM:PFM   7->66 PF07366 * SnoaL 7.4e-06 23.2 56/126  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86553.2 GT:GENE AAK86553.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 742332..742694 GB:FROM 742332 GB:TO 742694 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86553.2 GB:DB_XREF GI:159139760 LENGTH 120 SQ:AASEQ MTQHLTIAQTYLAAWNEEDNERRRHLVGQAWAENTRYVDPLMQGEGQQGIAAMIEAARQKFPGYRFVLAGTPDGHGNFTRFSWRLISPDGDDVAGGTDVVSLNTEGRIDNVVGFLDGAVS GT:EXON 1|1-120:0| SEG 89->100|dgddvaggtdvv| BL:PDB:NREP 1 BL:PDB:REP 2->118|3dxoB|3e-55|100.0|115/115| RP:PDB:NREP 1 RP:PDB:REP 7->117|3dxoA|2e-07|74.3|105/114| HM:PFM:NREP 1 HM:PFM:REP 7->66|PF07366|7.4e-06|23.2|56/126|SnoaL| RP:SCP:NREP 1 RP:SCP:REP 2->117|3dxoA1|3e-46|87.9|116/117|d.17.4.19| HM:SCP:REP 1->116|2a15A1|9.3e-08|25.0|112/0|d.17.4.3|1/1|NTF2-like| OP:NHOMO 42 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------11----12----------------11----121------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----------------------------1--111----1-11------------------------------------------------------------------------111111-----1111------1-11111--11--------1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 98.3 SQ:SECSTR cHHHHHHHHHHHcccHHHHHHHHHHHHHHHEEEEEEEEccccEEEHHHHHHHHHHHHHHHcTTcEEEEEEEEEEETTEEEEEEEEEcTTccEEEEEEEEEEEcTTccEEEEEEEEEcc## DISOP:02AL 1-2,120-121| PSIPRED cccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccEEccccccccHHHHHHHHHHHHHHccccEEEEcccccccccEEEEEEEEcccccccEEccEEEEEEcccccEEEEEEEEHHccc //