[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86571.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.204.1
:102 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->94 2q9lD PDBj 1e-05 35.5 %
:RPS:PDB   4->96 3crcA PDBj 2e-07 13.1 %
:RPS:SCOP  30->96 2a3qA1  a.204.1.2 * 6e-07 22.2 %
:HMM:SCOP  4->101 2a3qA1 a.204.1.2 * 2.5e-14 29.6 %
:RPS:PFM   32->91 PF01503 * PRA-PH 3e-04 46.8 %
:HMM:PFM   26->93 PF03819 * MazG 1.5e-08 38.2 55/74  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86571.1 GT:GENE AAK86571.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 758574..758882 GB:FROM 758574 GB:TO 758882 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86571.1 GB:DB_XREF GI:15155735 LENGTH 102 SQ:AASEQ MFADMMPRFEEASQKYAAENGIFRDPDWYMLKLQEEVGEVTQAWNRLTGRGRIKGRSKEEMKRDLADETADLLGHVLLLAHYNGLDIEGAIERKWRFAPSKP GT:EXON 1|1-102:0| BL:PDB:NREP 1 BL:PDB:REP 29->94|2q9lD|1e-05|35.5|62/78| RP:PDB:NREP 1 RP:PDB:REP 4->96|3crcA|2e-07|13.1|84/225| RP:PFM:NREP 1 RP:PFM:REP 32->91|PF01503|3e-04|46.8|47/85|PRA-PH| HM:PFM:NREP 1 HM:PFM:REP 26->93|PF03819|1.5e-08|38.2|55/74|MazG| GO:PFM:NREP 2 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF01503|IPR008179| GO:PFM GO:0004636|"GO:phosphoribosyl-ATP diphosphatase activity"|PF01503|IPR008179| RP:SCP:NREP 1 RP:SCP:REP 30->96|2a3qA1|6e-07|22.2|54/113|a.204.1.2| HM:SCP:REP 4->101|2a3qA1|2.5e-14|29.6|98/0|a.204.1.2|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------111111-111-1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 89.2 SQ:SECSTR ###ccHHHHHHHHHHHHccccTcccHHHHHHHHHHHHHHHHHHHHT####TcHHHccHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHH#### DISOP:02AL 1-7, 50-64, 99-102| PSIPRED cHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccc //