[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86597.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:190 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->44 PF06085 * Rz1 1.6e-05 34.3 35/59  
:HMM:PFM   70->119 PF00926 * DHBP_synthase 0.00017 30.0 50/194  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86597.1 GT:GENE AAK86597.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 786159..786731 GB:FROM 786159 GB:TO 786731 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86597.1 GB:DB_XREF GI:15155767 LENGTH 190 SQ:AASEQ MSGNFLRLSAAMSLLAVVAGCNSSNPSDSLAVNPPAAQANAVTPVVQANCPTVTVLDANAVHRVYAGGAKDDPQKLAYQVSLSDTTRSCSANESTLTVNVLAQGRLVPGPMAKPGRVTVPIRVTVKDGDGEIFGETTNFAIDVSAGGAGTQFIFNNDHVAIPNGPGGAARSVSVYIGFAEQGAKAKTKRR GT:EXON 1|1-190:0| SEG 6->19|lrlsaamsllavva| SEG 31->49|avnppaaqanavtpvvqan| HM:PFM:NREP 2 HM:PFM:REP 8->44|PF06085|1.6e-05|34.3|35/59|Rz1| HM:PFM:REP 70->119|PF00926|0.00017|30.0|50/194|DHBP_synthase| OP:NHOMO 36 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1--1111111111111111------1--11--111111111111-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 21-41, 183-190| PSIPRED ccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHcccccEEEEcccccEEEEEcccccccccEEEEEEEEEEcEEEEEEcccEEEEEEEEEEEEEEcccccccEEEEEEEEEEEEccEEEEEEEEEEEEEEccccccEEEEEEccccEEcccccccccEEEEEEEEcccccccccccc //