[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86603.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->66 PF01903 * CbiX 0.00097 23.1 39/105  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86603.1 GT:GENE AAK86603.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(792052..792285) GB:FROM 792052 GB:TO 792285 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86603.1 GB:DB_XREF GI:15155773 LENGTH 77 SQ:AASEQ MPLCISYEDSVQNLARFFKTDGEKKLAQAEMAVSGLRQSCRKRHRTQCFCELSEPDFHNHCSDLRQYCASLARNLSS GT:EXON 1|1-77:0| HM:PFM:NREP 1 HM:PFM:REP 27->66|PF01903|0.00097|23.1|39/105|CbiX| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 76-77| PSIPRED ccEEccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccc //