[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86624.2
DDBJ      :             sulfate adenylate transferase, subunit 2
Swiss-Prot:CYSD_AGRT5   RecName: Full=Sulfate adenylyltransferase subunit 2;         EC=2.7.7.4;AltName: Full=Sulfate adenylate transferase;         Short=SAT;AltName: Full=ATP-sulfurylase small subunit;

Homologs  Archaea  0/68 : Bacteria  447/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:317 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->227 1zunA PDBj 6e-64 68.5 %
:RPS:PDB   17->312 3dlaC PDBj 1e-20 9.4 %
:RPS:SCOP  23->227 1zunA1  c.26.2.2 * 2e-70 66.5 %
:HMM:SCOP  21->225 1zunA1 c.26.2.2 * 1.8e-66 40.0 %
:RPS:PFM   45->224 PF01507 * PAPS_reduct 8e-30 46.5 %
:HMM:PFM   44->272 PF01507 * PAPS_reduct 7.3e-64 49.4 170/174  
:BLT:SWISS 1->317 CYSD_AGRT5 e-176 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86624.2 GT:GENE AAK86624.2 GT:PRODUCT sulfate adenylate transferase, subunit 2 GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(815511..816464) GB:FROM 815511 GB:TO 816464 GB:DIRECTION - GB:PRODUCT sulfate adenylate transferase, subunit 2 GB:PROTEIN_ID AAK86624.2 GB:DB_XREF GI:159139785 LENGTH 317 SQ:AASEQ MSNAVHETDSKNTVASKPPLDPHLKALENEAIHIFREVAAEFDNPVMLYSIGKDSSVLLHLARKAFFPGRIPFPLLHVNTGWKFKEMIEFRDNIVKEYDLDLISYTNPRGALENVTPFSHGSALYTDIMKTEALRQALDAGQFDAAFGGARRDEEASRAKERIYSFRTPDHKWDPRNQRPELWNIYNGMVRKGESVRAFPLSNWTEVDIWRYIEAENIPLVPLYYAAERPYIERDGMMILAEDERLELLPGEEIKHGSIRFRTLGCFPLTGAIRSEAATLQDVIAELEIATVSERQGRAIDRDQSGSMEKKKREGYF GT:EXON 1|1-317:0| SW:ID CYSD_AGRT5 SW:DE RecName: Full=Sulfate adenylyltransferase subunit 2; EC=2.7.7.4;AltName: Full=Sulfate adenylate transferase; Short=SAT;AltName: Full=ATP-sulfurylase small subunit; SW:GN Name=cysD; OrderedLocusNames=Atu0817; ORFNames=AGR_C_1496; SW:KW ATP-binding; Complete proteome; Nucleotide-binding;Nucleotidyltransferase; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->317|CYSD_AGRT5|e-176|100.0|317/317| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 136->150|qaldagqfdaafgga| BL:PDB:NREP 1 BL:PDB:REP 23->227|1zunA|6e-64|68.5|184/196| RP:PDB:NREP 1 RP:PDB:REP 17->312|3dlaC|1e-20|9.4|276/657| RP:PFM:NREP 1 RP:PFM:REP 45->224|PF01507|8e-30|46.5|155/175|PAPS_reduct| HM:PFM:NREP 1 HM:PFM:REP 44->272|PF01507|7.3e-64|49.4|170/174|PAPS_reduct| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01507|IPR002500| GO:PFM GO:0016740|"GO:transferase activity"|PF01507|IPR002500| RP:SCP:NREP 1 RP:SCP:REP 23->227|1zunA1|2e-70|66.5|191/197|c.26.2.2| HM:SCP:REP 21->225|1zunA1|1.8e-66|40.0|205/0|c.26.2.2|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 510 OP:NHOMOORG 449 OP:PATTERN -------------------------------------------------------------------- 111-31-111111131111-11--11111111122234331112---11---111111--111-1122111-----------------111111------11-1111111---------------------11--2------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------11-11------------11----1-1---111111-----------1--1--11111-----111221111211211111111111-11111111111-11121121113311111--1-------1111111111111111------------------------------11111-111111121112222111122232222122211111111111111111111-11111--21111111111---------------2212112111-111---1-------------------11--1221111211-11111111111111111121211--121----1111111-111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1---------1-12111-1-1---------1111111---1111111211111111111-----1----11111111111111--111111111111--1-111111----------------------------------------------121 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 298 STR:RPRED 94.0 SQ:SECSTR ###############THHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHGEETTccGGGEEEEEcccccHHHHHHHHHHTcEEEEcccHHHHHHHHHHHTcGGGGTcccccHHHHHHHHHHHTccEEEHHHHHHHHHHHHHHHHHHHHHHTEEEEEcccHHHHHHTcccccccTTcccEETTTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccTTcccccccccGGGcccccHHHHHHHHHHHHHHHHTTcHHHHHE#### DISOP:02AL 1-1| PSIPRED cccccccccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEcHHHHHHccccccccHHHHHHcccHHHHHHHHHHHcccEEEEEEEcccccccccccEEEccccccccccccccHHHHHHcccccccccEEEEEEcccccHHHHHHHHHHHccccccHHHHcccccccccccEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHcccccHHHHHHHcccc //