[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86632.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  570/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.1.33d.37.1d.58.29
:603 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->249 3gg0A PDBj 5e-22 32.5 %
:BLT:PDB   453->518 3ignA PDBj 1e-05 36.9 %
:RPS:PDB   27->321 2basA PDBj 2e-40 18.5 %
:RPS:PDB   411->523 3btaA PDBj 5e-13 8.0 %
:RPS:SCOP  31->250 2basA1  c.1.33.1 * 6e-46 24.1 %
:RPS:SCOP  288->409 2v8qE1  d.37.1.1 * 1e-10 12.7 %
:RPS:SCOP  423->518 1w25A3  d.58.29.2 * 5e-12 26.3 %
:HMM:SCOP  7->249 2basA1 c.1.33.1 * 7.6e-53 33.5 %
:HMM:SCOP  264->339 1yavA2 d.37.1.1 * 7.2e-05 21.7 %
:HMM:SCOP  423->601 1w25A3 d.58.29.2 * 5e-20 25.8 %
:RPS:PFM   28->249 PF00563 * EAL 2e-35 39.0 %
:RPS:PFM   421->517 PF00990 * GGDEF 9e-09 34.7 %
:HMM:PFM   27->249 PF00563 * EAL 7e-54 35.8 218/236  
:HMM:PFM   422->524 PF00990 * GGDEF 3.1e-14 32.4 102/161  
:HMM:PFM   281->335 PF00571 * CBS 3.8e-07 20.0 50/57  
:BLT:SWISS 9->259 Y3085_AZOC5 1e-24 34.0 %
:BLT:SWISS 453->518 YEDQ_SHISS 5e-06 33.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86632.1 GT:GENE AAK86632.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(824034..825845) GB:FROM 824034 GB:TO 825845 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86632.1 GB:DB_XREF GI:15155808 LENGTH 603 SQ:AASEQ MQAVALENDVIRRFASGQMFPMAKLVLETAFQPIVEATTGTIFGYESLMRGHDRLGFSSPLALLDQAAADGELKAFEQMLASRALAKFSTLPDFSSATLFLNLDVRLIPHGDVILDKLVGHLARAGIPASSICFELSERFDNTSVPEFTSLIARMRKEGFKLAIDDFGAGHGEMKLLCDFPLDYLKIDRHFISGIDHLPRKQHLVRNIVNIAHVLGVRVIAEGIETEAEFLSCREFGVDLVQGWLIAKPTVFTSELPESFPHLNRVGVARRNSQTLDEILIRREIERLPTVFEHDSVDSVFELFRRNPQQAFFPVLNANGEPRGVINEYHLKEYIYRPFGRDLLKNKIYERTISHFVDPAPIVGLDADADQLMNMFASMGGMGGSACIILTENMRYAGIVSAASLIKVINEKQLKMAQDQNPLTALPGNRAIGGFIADSCSDGDETRFFCYCDFDNFKPFNDKYGFNAGDHAITLFSALMRRYFFAGDCFLGHIGGDDFFIGVRDWSVEELMEILERLLSDFHDDVAGLYSDEDRAAGCMKGQDRNGNERDFALLRCSIGVLTLPKGSIIANPERIGSEIASVKAAAKENEGGLVVRVFGEAN GT:EXON 1|1-603:0| BL:SWS:NREP 2 BL:SWS:REP 9->259|Y3085_AZOC5|1e-24|34.0|241/735| BL:SWS:REP 453->518|YEDQ_SHISS|5e-06|33.8|65/569| SEG 377->386|asmggmggsa| BL:PDB:NREP 2 BL:PDB:REP 30->249|3gg0A|5e-22|32.5|212/392| BL:PDB:REP 453->518|3ignA|1e-05|36.9|65/161| RP:PDB:NREP 2 RP:PDB:REP 27->321|2basA|2e-40|18.5|286/393| RP:PDB:REP 411->523|3btaA|5e-13|8.0|112/1277| RP:PFM:NREP 2 RP:PFM:REP 28->249|PF00563|2e-35|39.0|218/236|EAL| RP:PFM:REP 421->517|PF00990|9e-09|34.7|95/160|GGDEF| HM:PFM:NREP 3 HM:PFM:REP 27->249|PF00563|7e-54|35.8|218/236|EAL| HM:PFM:REP 422->524|PF00990|3.1e-14|32.4|102/161|GGDEF| HM:PFM:REP 281->335|PF00571|3.8e-07|20.0|50/57|CBS| RP:SCP:NREP 3 RP:SCP:REP 31->250|2basA1|6e-46|24.1|212/257|c.1.33.1| RP:SCP:REP 288->409|2v8qE1|1e-10|12.7|118/145|d.37.1.1| RP:SCP:REP 423->518|1w25A3|5e-12|26.3|95/162|d.58.29.2| HM:SCP:REP 7->249|2basA1|7.6e-53|33.5|233/0|c.1.33.1|1/1|EAL domain-like| HM:SCP:REP 264->339|1yavA2|7.2e-05|21.7|69/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 423->601|1w25A3|5e-20|25.8|159/0|d.58.29.2|1/1|Nucleotide cyclase| OP:NHOMO 5082 OP:NHOMOORG 577 OP:PATTERN -------------------------------------------------------------------- 71137---111----3322-2822-122222-54442432A88AV-------257-----872-62A5442----1----A1567B68--------------------1---------------------------56644---53UHEEAA-1-77---2--8D5-77B3------------B-31---1761666664561666666-1--1266655471BA22222276--------------------------3---------------------------------------------------------------4344911111115161H663332512--3675143521---212223---64369941111124PGG757GEDFJ44554553546-MIGHH6CM8I3-GEEGLNILMLEDE88A72817A55782--------B994-P7H--------11111111111111111-----8A87396612B9A9BB86565AAKO888867BDL7AAK--HHDMBIAAK13T54FFHHEOTLC-------65BLRS13742588389BBA-878E893GB11113112A331----------------ECCJC43IC7MLGRHQHYQTQQSLQHPMLNKKIHMKM---BKBO------AE732F6CCCBCBDCBB-ACBDCB9CBCACBABBBCDEEB66---A67ABBAAAA9AA9AA78645586--6222222-1222---E-1-1-89A9A2YBJ---------------4444413---BLHJMHLTLOMKLKLFKKM-----2---H4A9BFFFFFJKHQOABDEDEEBBE1111--I-775378111-1---2-3-------------------------1--11-1------ --------------------------------------------------------------------------------------------------------------------------------------------------------------1----3-1-------7-----------1--5-----3---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 531 STR:RPRED 88.1 SQ:SECSTR ################ccHHHHHHHHEEEEEEEEEEcccccEEEEEEEEEEETTEEEEcHHHHccccccHHHHHHHHHHHHHHHHHHHTTccTTcEcEEEEccHHHHGGTTHHHHHHHHHHHHHTTccGGGEEEEEccTcTccccHHHHHHHHHHHTTTcEEEEEEETTTcccHHHHHHHcccEEEEEcTTTcccHHcTTcHHHHHHHHHHHHHHTcEEEEEccccHHHHHHHHHTTEEEEccTTTTcccccccccTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHTGGGccEEEEETTccEcccEEEEccccEEEEGGGTTHTcTHHHHTccHHHHcccccccTTccHHHHHHHHTTccHHTccEEEEEcTTHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHccHHHHHHHTTEEEccGGGcccGGGGEEEcccccccccHHHHHcHcTTTHHHHHHHHHHHHccEEEEEcccHHHHHHHTccEcHHHHHHHHHHHHccEEcHH######################################################## DISOP:02AL 270-284| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEccccEEEEEEEEEEEccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHcccHHHHHHHHHHHHHcccHHHEEEEEEHHHHHccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEEEcHHHHccccccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHccccEEcHHHccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHcHHHHHHHHHHcccccEEHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccEEEEccccEEEEEHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHccEEEEcccccccccHHHEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHcccccEEEEccccc //