[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86633.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.43.1
:78 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->77 2cadA PDBj 6e-08 15.6 %
:RPS:SCOP  1->39 2bj1A1  a.43.1.3 * 8e-06 17.9 %
:HMM:SCOP  1->48 1q5vA1 a.43.1.3 * 1.6e-06 33.3 %
:HMM:PFM   6->39 PF03693 * RHH_2 2.6e-07 38.2 34/81  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86633.1 GT:GENE AAK86633.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(826018..826254) GB:FROM 826018 GB:TO 826254 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86633.1 GB:DB_XREF GI:15155809 LENGTH 78 SQ:AASEQ MPMVTVSISPEQAARMREAVNCGAYASGSEVVREALRLWAASAAHGTGAKSTQPVEADRERLNVAELYAAHSGHIRRA GT:EXON 1|1-78:0| RP:PDB:NREP 1 RP:PDB:REP 1->77|2cadA|6e-08|15.6|77/131| HM:PFM:NREP 1 HM:PFM:REP 6->39|PF03693|2.6e-07|38.2|34/81|RHH_2| RP:SCP:NREP 1 RP:SCP:REP 1->39|2bj1A1|8e-06|17.9|39/50|a.43.1.3| HM:SCP:REP 1->48|1q5vA1|1.6e-06|33.3|48/48|a.43.1.3|1/1|Ribbon-helix-helix| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 100.0 SQ:SECSTR cccccccccHHHHHHHHHHHHHHTcccHHHHHHHHHHHHccccccccEEEEEEEEEETTcTHHHHHHHHHcccEEEEE DISOP:02AL 1-2, 48-51, 53-54, 76-78| PSIPRED ccEEEEEEcHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccc //