[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86646.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  128/915 : Eukaryota  135/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->309 2i7vA PDBj 2e-12 27.8 %
:RPS:PDB   9->328 3bk1A PDBj 1e-17 13.6 %
:RPS:SCOP  15->233 2dkfA1  d.157.1.10 * 2e-24 28.8 %
:HMM:SCOP  20->184 1ycgA2 d.157.1.3 * 2.6e-20 22.2 %
:HMM:PFM   19->122 PF00753 * Lactamase_B 8.6e-08 13.5 104/194  
:BLT:SWISS 8->310 DNLI_OPITP 1e-25 30.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86646.2 GT:GENE AAK86646.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 838736..839731 GB:FROM 838736 GB:TO 839731 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86646.2 GB:DB_XREF GI:159139799 LENGTH 331 SQ:AASEQ MLNSTPKGLYCPAGDFYIDPVRPVARALITHGHSDHARAGHGAVLATRQTLDIMRIRYGEDFCGSEQAVGFGETVEVNGVIVGFHPAGHVLGSAQISVEMNGLRIVASGDYKRGIDPTCAPFETVPCDVFITEATFGLPVFHHPLPRVEIGKLLTSIKQFPDRTHLVGAYSLGKAQRVIRLLRDNGYADPIYIHGALARLCDYYVSQGIDLGDLRPATLEKSNPAAFKGAIVVGPPSAFQERWARRFNEPLIAFASGWMMVRQRAKQGGVELPLVISDHCDWPELLETITEIGPQAVWVTHGREEALVRWCELQGIAAKPLHLVGYEDEGD GT:EXON 1|1-331:0| BL:SWS:NREP 1 BL:SWS:REP 8->310|DNLI_OPITP|1e-25|30.0|293/1017| BL:PDB:NREP 1 BL:PDB:REP 17->309|2i7vA|2e-12|27.8|291/433| RP:PDB:NREP 1 RP:PDB:REP 9->328|3bk1A|1e-17|13.6|317/537| HM:PFM:NREP 1 HM:PFM:REP 19->122|PF00753|8.6e-08|13.5|104/194|Lactamase_B| RP:SCP:NREP 1 RP:SCP:REP 15->233|2dkfA1|2e-24|28.8|212/431|d.157.1.10| HM:SCP:REP 20->184|1ycgA2|2.6e-20|22.2|162/0|d.157.1.3|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 333 OP:NHOMOORG 298 OP:PATTERN 11-1211-1111111---1211-1----1------11-----------11111--111111---1-11 --1---------------------------------------------------1--------------------------------------------1-1-11111-2--------------1---------------1----------------111111--------1---111-1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111-----1111111111111----------1-1111111111--11111111111111-1-11111111----------1---1-1-------------------------------1111------------1------11--------111----111-11111---1---------------------1-------------------------11112---------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111------------------------1111111111-------------------------------------------------------------1- -1-111--1---1111--1111111111111-11111211111111111-111111111111111111--1111-111-1111111-1-1----11-----1111111-12122311-----1111---251-1-1----1--1-11---1--1-111112-111111116---11--1811-112113122------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 326 STR:RPRED 98.5 SQ:SECSTR ###ccHHcEEEEccHHHHHcGGGEEEEEcccccHHHHTTHHHHHHHTcccEEEEHHTTccTTcEEEEEccTTcEEEETTTEEEEEEcccccccEEEEEEETTEEEEEccccccccccTTccccccHccEEEEEcTcTTcccccccHHHHHHHHHHHHTccccEEEEccTTcHHHHHHHHHHHHHTTcEEEEcHHHHHHHHHHHHTccccccccccHHHHTTccGGGEGGTEEEEccTTcccHHHHHHHTTccccccTcHHHHHHHHHHHHHTTccccccccHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHTcccccEEccccTTEE## DISOP:02AL 139-147,241-242,328-332| PSIPRED ccccccccEEcccccccccccccccEEEEEcccHHHHccccccEEEcHHHHHHHHHHccccccccEEEcccccEEEEccEEEEEEEcccccccEEEEEEEccEEEEEEccccccccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHccccccccEEEEcccccccccccEEEEcHHHHHHHHHHcccccEEEEccccEEEEEEEEEccEEEEEEEcccccHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHccccEEEEcccccccccc //