[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86655.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   74->125 PF09722 * DUF2384 1.3e-13 37.3 51/54  
:HMM:PFM   21->49 PF02954 * HTH_8 0.00012 41.4 29/42  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86655.2 GT:GENE AAK86655.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 849385..849768 GB:FROM 849385 GB:TO 849768 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86655.2 GB:DB_XREF GI:159139805 LENGTH 127 SQ:AASEQ MNIHAKTAMDPASQGRVVTKAVIAAAERLGLNAARTADILGVSAPTVSRMRRLDFLLEPGAKSFELAVLLIRVFRSLDAITGGDEAVAKNWLRNHNTALDAVPAERLTTITGLIDVLSYLDARRAPV GT:EXON 1|1-127:0| HM:PFM:NREP 2 HM:PFM:REP 74->125|PF09722|1.3e-13|37.3|51/54|DUF2384| HM:PFM:REP 21->49|PF02954|0.00012|41.4|29/42|HTH_8| OP:NHOMO 33 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------1--1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------1---111---------1-1--------------------------11--------------------------------1------1------------------------1111-1-----------1----------------------11----------------111--1----1------------------------------------1------1------------------------1-------------------------------------------------------------------------------------------------------------------------------------1--------1--------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,53-55| PSIPRED cccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccEEHHHHHHHHHHHHHHHHHHHHHccc //