[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86658.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  112/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->116 1s7iA PDBj 1e-05 24.7 %
:RPS:SCOP  4->112 1mwqA  d.58.4.7 * 3e-13 11.1 %
:HMM:SCOP  1->118 1s7iA_ d.58.4.9 * 7.3e-37 36.2 %
:RPS:PFM   30->114 PF03795 * YCII 4e-05 37.3 %
:HMM:PFM   1->115 PF03795 * YCII 1.2e-21 28.7 94/95  
:BLT:SWISS 23->112 Y369_RHIME 3e-05 23.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86658.1 GT:GENE AAK86658.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(852456..852878) GB:FROM 852456 GB:TO 852878 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86658.1 GB:DB_XREF GI:15155840 LENGTH 140 SQ:AASEQ MRAIVFVKATKSSEEGVMPTTELMEAMGKFNEELVNAGIMQSGDGLHPSSKGKRVVFDGDSRTVVNGPFPHTNELVAGFWIWKVKDMDEAVEWVKRCPNPMLEKSEIEIRPMFEMEDFGDAVTPEIAAHVEELRARVGKQ GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 23->112|Y369_RHIME|3e-05|23.3|90/124| BL:PDB:NREP 1 BL:PDB:REP 30->116|1s7iA|1e-05|24.7|85/124| RP:PFM:NREP 1 RP:PFM:REP 30->114|PF03795|4e-05|37.3|67/94|YCII| HM:PFM:NREP 1 HM:PFM:REP 1->115|PF03795|1.2e-21|28.7|94/95|YCII| RP:SCP:NREP 1 RP:SCP:REP 4->112|1mwqA|3e-13|11.1|90/100|d.58.4.7| HM:SCP:REP 1->118|1s7iA_|7.3e-37|36.2|116/124|d.58.4.9|1/1|Dimeric alpha+beta barrel| OP:NHOMO 163 OP:NHOMOORG 122 OP:PATTERN -------------------------------------------------------------------- -21-1--------------------1-------1112121-1-1-2--1---1-----------12-1111-----------------------------------------------------------------------------------------------1--1-----------------------------------------------------1--------1--------------------------------------------------------------------------------------------------------------------------------------------1-1---2------12221--1-111-----------------2--12--211--1-111--11------1-11-----------------1---------------------------------11--11-1222222-222222222222-2221-11-----111-----112--1----------------1---------------------------212115----------------------------------2---------------------------------------------------------------------------------------------------------------------------------------1----------------------------11111--1-1----1---------------------------11-1-11------------------------------------------------------------------ ---------------------------111--1---------------11-111--------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 60.7 SQ:SECSTR #############################HHHHHHHHTcEEEEEEcccGGGcEEEEEccccEEEEEccccccccEEEEEEEEEEccHHHHHHHHTTcGGGGG##cEEEEEEccccc######################## DISOP:02AL 16-17, 136-140| PSIPRED cEEEEEEEcccccHHcccccHHHHHHHHHHHHHHHHccEEEEccccccHHHcEEEEEEcccEEEEEcccccHHHHHccEEEEEcccHHHHHHHHHHcccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHccc //