[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86660.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  100/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:242 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  110->190 3er7A1  d.17.4.24 * 3e-04 11.4 %
:RPS:PFM   4->229 PF05988 * DUF899 2e-69 65.2 %
:HMM:PFM   2->231 PF05988 * DUF899 8.5e-91 61.7 209/211  
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86660.2 GT:GENE AAK86660.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 853560..854288 GB:FROM 853560 GB:TO 854288 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86660.2 GB:DB_XREF GI:159139808 LENGTH 242 SQ:AASEQ MSHPVVSKEEWLAARRDLLVKEKELTRARDRLNEARRALPWEEVTKDYIFDAPSGPRSLQELFGDCSQLIVYHFMLAPDWEEGCVGCSFFADHVDGALVHLRHGDAGFVAVSRAPLEKIEGYKNRMGWKFPWVSAEGSDFNYDYQASFRDEDVEKGEITYNYRDMAPFGDLKDLHGISVFAKGEDGKIYHTYSTYARGAEQTLGTLMLLDLVPKGRNEDEVMDWVRRHDQYEDAPKAASCCH GT:EXON 1|1-242:0| COIL:NAA 32 COIL:NSEG 1 COIL:REGION 8->39| RP:PFM:NREP 1 RP:PFM:REP 4->229|PF05988|2e-69|65.2|204/209|DUF899| HM:PFM:NREP 1 HM:PFM:REP 2->231|PF05988|8.5e-91|61.7|209/211|DUF899| RP:SCP:NREP 1 RP:SCP:REP 110->190|3er7A1|3e-04|11.4|79/118|d.17.4.24| OP:NHOMO 177 OP:NHOMOORG 106 OP:PATTERN -------------------------------------------------------------------- -21-1---------1------2--12------3333--14--11-11-------------11--2-3-13-----------------------------------1-1------------------------------------1-----------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------1----------2211----11-----------2---------132-211-44344434-------1-------------------------------------------------------2---21-1111111-22211134222212113-121--221-------2-2----------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-111111--------------------------------------------------------------------------------------------------1- -----------------------1-11---------------------11--1-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,236-237| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEcccccEEHHHHHccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHcccccEEEEccccccccEEEEEcHHHHcccccccccccccccccccccccEEEEEEccccEEEEEccccccccccccHHHHHHHcccccccccccccccccccccccccccccccc //