[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86663.2
DDBJ      :             transcriptional regulator, LysR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  378/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1e.10.1
:254 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->246 3hhgG PDBj 1e-17 26.0 %
:RPS:PDB   47->249 1al3A PDBj 5e-21 12.6 %
:RPS:SCOP  2->26 1cy0A  e.10.1.1 * 9e-04 16.0 %
:RPS:SCOP  48->253 1al3A  c.94.1.1 * 1e-21 13.9 %
:HMM:SCOP  1->70 1b9mA1 a.4.5.8 * 4.6e-06 34.9 %
:HMM:SCOP  40->249 1uthA_ c.94.1.1 * 3.5e-39 27.8 %
:RPS:PFM   48->249 PF03466 * LysR_substrate 5e-10 28.9 %
:HMM:PFM   45->249 PF03466 * LysR_substrate 9.7e-40 28.1 199/209  
:HMM:PFM   2->20 PF00126 * HTH_1 0.00022 47.4 19/60  
:BLT:SWISS 3->249 YCAN_ECOLI 2e-42 35.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86663.2 GT:GENE AAK86663.2 GT:PRODUCT transcriptional regulator, LysR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(855732..856496) GB:FROM 855732 GB:TO 856496 GB:DIRECTION - GB:PRODUCT transcriptional regulator, LysR family GB:PROTEIN_ID AAK86663.2 GB:DB_XREF GI:159139810 LENGTH 254 SQ:AASEQ MGIALVRRTTRSVSLTEAGQQLYADVSPSIGAISQAAQAASSLSGTVRGQLRLAVSSIAERFLSGPLLASFADAHPDVQLDIVVTDEEFDIVAEQYDAGVRLGELIEQDMIAVPVSVPQRQLAVCSAEYRDRFGLPTQPRELIDHRCIGWRARPGVAPYRWEFAENGREFAVAVQPDFTTNDMQLMIKLACAGAGITFGMEETFRPHLESGKLIAMLEDYSPVFAGFYLYYPSRRHIAPKLRAFIDHVRLSRER GT:EXON 1|1-254:0| BL:SWS:NREP 1 BL:SWS:REP 3->249|YCAN_ECOLI|2e-42|35.4|243/302| SEG 29->45|sigaisqaaqaasslsg| BL:PDB:NREP 1 BL:PDB:REP 1->246|3hhgG|1e-17|26.0|242/294| RP:PDB:NREP 1 RP:PDB:REP 47->249|1al3A|5e-21|12.6|199/237| RP:PFM:NREP 1 RP:PFM:REP 48->249|PF03466|5e-10|28.9|197/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 45->249|PF03466|9.7e-40|28.1|199/209|LysR_substrate| HM:PFM:REP 2->20|PF00126|0.00022|47.4|19/60|HTH_1| RP:SCP:NREP 2 RP:SCP:REP 2->26|1cy0A|9e-04|16.0|25/534|e.10.1.1| RP:SCP:REP 48->253|1al3A|1e-21|13.9|202/237|c.94.1.1| HM:SCP:REP 1->70|1b9mA1|4.6e-06|34.9|63/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 40->249|1uthA_|3.5e-39|27.8|205/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 4280 OP:NHOMOORG 387 OP:PATTERN -------------------------------------------------------------------- -------------------------1------------------------------------------------------------------------------------------------------------------------511111-----------12-2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--F221-----J5MEE344382644444344344B-9D975C8DAS2-ZPP7QSGiWQSTFC23428842442624444444468966438-------------------------------49547HD7Ojwzu*rNGIJFZZpgOOOOFS*WjHVWK--IHN78C67YALAd25I51659L622222221213E65------1--1-------------57376F---------------------------11HDH454Q2B958FGGF8EDDBBADCEHCLH---11-2------BD7J1F97998878776-988887588897A887883UYSHF2627586878789777766X64544543-C77777767777---1-1--1112112H9C55581B-112-2---GHFFH68455S4TTRTLTYQFIKLM8IIM11-1-21-11CDENAAAAABHHEDRS9DDDB1124111--1-------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------1--------------1----2------F--5----------11--6-----4---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 249 STR:RPRED 98.0 SQ:SECSTR HTTccEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcccHccEEEEEEEEcHHHHHHTcHHHHHHHHHHcTEEEEEEEEccHHHHHHTTcccEEEEcccccTTccEEEEEEEEEcEEEEEcTTcTTTTTccccHHHHHTcEEEEEcTTcTHHHTHHHHHHHHHHHTcccEEEEEEccHHHHHHHHHHTccEEEEEEGGGccTTTcTTcEEEEccTTcccEEEEEEEETTccccHHHHHHHHHHc##### DISOP:02AL 42-44| PSIPRED ccccccccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccEEEEEcccccccEEEEEEcccccEEEEEcHHHHHHccccccHHHHHcccEEEEEcccccccEEEEEccccEEEEEEccccEEEccHHHHHHHHHccccEEEccHHHHHHHHHccccEEEccccccccccEEEEccccccccHHHHHHHHHHHHHHcc //