[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86672.1
DDBJ      :             transcriptional regulator, AraC family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  243/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1b.82.4
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   181->264 1d5yA PDBj 4e-07 34.5 %
:RPS:PDB   16->139 2arcB PDBj 1e-08 15.3 %
:RPS:PDB   168->266 1bl0A PDBj 2e-21 28.3 %
:RPS:SCOP  26->154 1xjaA  b.82.4.1 * 1e-14 17.2 %
:RPS:SCOP  175->267 1v4aA1  a.24.16.4 * 6e-17 15.1 %
:HMM:SCOP  8->156 2arcA_ b.82.4.1 * 9.8e-14 20.8 %
:HMM:SCOP  164->217 1bl0A1 a.4.1.8 * 2.4e-10 33.3 %
:HMM:SCOP  218->266 1d5yA2 a.4.1.8 * 5.7e-09 38.8 %
:RPS:PFM   18->99 PF02311 * AraC_binding 5e-05 28.0 %
:HMM:PFM   23->149 PF02311 * AraC_binding 3.6e-26 27.2 125/136  
:HMM:PFM   175->215 PF00165 * HTH_AraC 3.7e-11 36.6 41/42  
:HMM:PFM   238->264 PF00165 * HTH_AraC 0.00025 42.3 26/42  
:BLT:SWISS 25->263 YBFI_BACSU 4e-20 24.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86672.1 GT:GENE AAK86672.1 GT:PRODUCT transcriptional regulator, AraC family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 862009..862815 GB:FROM 862009 GB:TO 862815 GB:DIRECTION + GB:PRODUCT transcriptional regulator, AraC family GB:PROTEIN_ID AAK86672.1 GB:DB_XREF GI:15155854 LENGTH 268 SQ:AASEQ MGQAQFLMPKTVLPGVAAVVADSDRSFPRHMHDQFGIGLIARGAQKSLSGRGMVEAGAGHVITVNPGEVHDGIPLGEGGRAWRMLYLDIEIVRDAIADISEKDRGTFEFAYPVDTRPLAKRFNAVFSAVTAKERPGETLDSDETLLMFLADAMETAANPPVVAAPDTIKRAKSSIDDDPARPFRLADLAKEAGMSQFRFLRAFAKATGLTPHSYLLQRRVHLARHALADGTRPAEAAVIAGFVDQSHLNRFFVRQFGVTPAVYRAALS GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 25->263|YBFI_BACSU|4e-20|24.7|239/275| BL:PDB:NREP 1 BL:PDB:REP 181->264|1d5yA|4e-07|34.5|84/288| RP:PDB:NREP 2 RP:PDB:REP 16->139|2arcB|1e-08|15.3|124/164| RP:PDB:REP 168->266|1bl0A|2e-21|28.3|99/116| RP:PFM:NREP 1 RP:PFM:REP 18->99|PF02311|5e-05|28.0|82/130|AraC_binding| HM:PFM:NREP 3 HM:PFM:REP 23->149|PF02311|3.6e-26|27.2|125/136|AraC_binding| HM:PFM:REP 175->215|PF00165|3.7e-11|36.6|41/42|HTH_AraC| HM:PFM:REP 238->264|PF00165|0.00025|42.3|26/42|HTH_AraC| GO:PFM:NREP 1 GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02311|IPR003313| RP:SCP:NREP 2 RP:SCP:REP 26->154|1xjaA|1e-14|17.2|128/165|b.82.4.1| RP:SCP:REP 175->267|1v4aA1|6e-17|15.1|93/151|a.24.16.4| HM:SCP:REP 8->156|2arcA_|9.8e-14|20.8|149/0|b.82.4.1|1/1|Regulatory protein AraC| HM:SCP:REP 164->217|1bl0A1|2.4e-10|33.3|54/54|a.4.1.8|1/2|Homeodomain-like| HM:SCP:REP 218->266|1d5yA2|5.7e-09|38.8|49/0|a.4.1.8|2/2|Homeodomain-like| OP:NHOMO 684 OP:NHOMOORG 243 OP:PATTERN -------------------------------------------------------------------- ----3--1-------1-----1---1------3---31-1-2--1-------1--------------331----------1--------------------11--1---------------------------------1----1-512-----------------1111---------------------------------------1-1--1----1------------2---------------------------------------------------------------------------------------------12----------1111------2-------1----------------1-31---------1931---31-21----------2-222123-2251-63336568757762---12321332-122222222223----1-------------------------------11--122-4C88B9B3333377A95555259794212--333-1---5---4--3----131-----------1--1----1--17113----------1--133--1--------------------11----331-1-1----14333---222222-1213-------------2221-4-------------------------------22364----1---1---11----12-------1-1--------------------------424---------------3333414---1-66864764364784231----------21141111111121131-2--------------1---------------------------------------------------2- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 250 STR:RPRED 93.3 SQ:SECSTR ###############EETTcTTcccEEETTccccEEEEEEEEEcEEEEETTEEEEEcTTcEEEEcTTccEEEEEcTTcEEEEEEEEEcccGGGGGGGcccEEETTEEEEcccTTTHHHHHHHHHHHHHHTcccTTHHHHHHHHHHHHHHcHHHHHHTTccH#HHHHHHHHHHHHHHTTTTcccccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHTTcccHHHHHHHHHHHHcccHHHHHTc## DISOP:02AL 1-3, 153-166| PSIPRED cccccEEEcccccccEEEEEEcccccccccccccEEEEEEEEcEEEEEEccEEEEEcccEEEEEccccEEEEEEcccccEEEEEEEEcHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHcc //