[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86673.2
DDBJ      :             RhtB family transporter
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  312/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:203 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->185 PF01810 * LysE 4e-13 32.7 %
:HMM:PFM   10->200 PF01810 * LysE 5.9e-35 23.4 188/192  
:BLT:SWISS 5->135 RHTB_SHIFL 1e-16 29.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86673.2 GT:GENE AAK86673.2 GT:PRODUCT RhtB family transporter GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 863160..863771 GB:FROM 863160 GB:TO 863771 GB:DIRECTION + GB:PRODUCT RhtB family transporter GB:PROTEIN_ID AAK86673.2 GB:DB_XREF GI:159139813 LENGTH 203 SQ:AASEQ MTPEFLITSFIVAASPGTGVVYTLAAGLSQGAKASIIAAFGCTLGIVPHLLAAITGLAAILHTSALAFGIVKYLGVAYLLYMAWNTLRENGALKIDETRQPQKPARVIGEAILINLLNPKLSIFFFAFLPQFIAPGELSPTWRMIDLGLIFMALTFLVFALYGCFAASVRRQVVSRPAVLAWLRRSFAAAFVALGAKLAFTER GT:EXON 1|1-203:0| BL:SWS:NREP 1 BL:SWS:REP 5->135|RHTB_SHIFL|1e-16|29.0|131/206| TM:NTM 6 TM:REGION 5->27| TM:REGION 36->58| TM:REGION 66->88| TM:REGION 112->134| TM:REGION 145->167| TM:REGION 176->198| SEG 49->63|hllaaitglaailht| SEG 187->200|faaafvalgaklaf| RP:PFM:NREP 1 RP:PFM:REP 15->185|PF01810|4e-13|32.7|168/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 10->200|PF01810|5.9e-35|23.4|188/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 661 OP:NHOMOORG 322 OP:PATTERN ----------------------------1---------11111-------111--------------- ----1----------------1---2------2---222--1----------122---------1-61-1---------------------------------1-----1----------------1-11---1----------1----------------------------------------1--------111113131211121-211--121-431---------4-------------------------------------------------------------------------------------------------------------------1----------1-----------------222-111-1--511-1-1112111-11111--3--1-1121128--7663435645221----1211-11123---------111-1-------------------------------------344135668754222255562222227245262--556121323-61511-3--1-2------------1--11-5-4--14-----2-212-12----1-------1----------------1-----124-2-1-211-2122111-1--1-23-22-------------1232-122212222222-2222222222222222221232141--11111111111111111-11--11--1-------------------------1421111------------3334311111--11113642122213112-----------115332334342222--------1111---------------------------------------------------------1- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 88-106| PSIPRED ccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcc //