[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86676.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:122 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->122 2kjzA PDBj 6e-70 100.0 %
:RPS:PDB   3->118 1bylA PDBj 3e-13 9.6 %
:RPS:SCOP  3->118 1bylA  d.32.1.2 * 1e-13 9.6 %
:HMM:SCOP  1->122 1q0oA2 d.32.1.3 * 3.7e-20 29.8 %
:HMM:PFM   8->115 PF00903 * Glyoxalase 1e-12 24.1 108/128  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86676.1 GT:GENE AAK86676.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 865638..866006 GB:FROM 865638 GB:TO 866006 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86676.1 GB:DB_XREF GI:15155860 LENGTH 122 SQ:AASEQ MTHPDFTILYVDNPPASTQFYKALLGVDPVESSPTFSLFVLANGMKLGLWSRHTVEPKASVTGGGGELAFRVENDAQVDETFAGWKASGVAMLQQPAKMEFGYTFTAADPDSHRLRVYAFAG GT:EXON 1|1-122:0| BL:PDB:NREP 1 BL:PDB:REP 1->122|2kjzA|6e-70|100.0|122/122| RP:PDB:NREP 1 RP:PDB:REP 3->118|1bylA|3e-13|9.6|115/122| HM:PFM:NREP 1 HM:PFM:REP 8->115|PF00903|1e-12|24.1|108/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 3->118|1bylA|1e-13|9.6|115/122|d.32.1.2| HM:SCP:REP 1->122|1q0oA2|3.7e-20|29.8|114/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 50 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11-----------------------------1--1111221112-111--------------------------------------------------------------------2---------------------1-----------------------------1------------------------------------------------------------------------111------------------------------------------11-------------------------------------2111------------------------------------------------1211--1-1--------------------------------1-1----------------------------11--211----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 100.0 SQ:SECSTR GGcccccEEEEccHHHHHHHHHHTTccEEEEEcccEEEEEETTEEEEEEEEcccTTTGGGcEEEEEEccHHHHHHHHHTTcccccccccccEEcccEEETTEEEEEEEcTTccEEEEEccEc PSIPRED cccccEEEEEEccHHHHHHHHHHHHccEEEEEcccEEEEEcccccEEEEEcccccccccccccccEEEEEEEccHHHHHHHHHHHHHcccEEEEccccccccEEEEEEcccccEEEEEEEcc //