[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86682.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   99->140 2cw5A PDBj 2e-04 35.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86682.1 GT:GENE AAK86682.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(872284..872763) GB:FROM 872284 GB:TO 872763 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86682.1 GB:DB_XREF GI:15155866 LENGTH 159 SQ:AASEQ MKYQNVPTKEKIPLKPAATTFVSQPWRTVFHPIGSLLMTLQEGNSMTRALIRPLILAAALSSLALPAAASSDDAWKEFVADVQTACLTGAKDMLEDAKAVVDPVGSENYGLAILTGKTKGADATVSHICVYDKKTKAVELGSELAGDTLKVEIPGSTKP GT:EXON 1|1-159:0| SEG 48->74|ralirplilaaalsslalpaaassdda| RP:PDB:NREP 1 RP:PDB:REP 99->140|2cw5A|2e-04|35.7|42/233| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11-111----------1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 42 STR:RPRED 26.4 SQ:SECSTR ##################################################################################################EEccTTTccccEEEEEcccEEEEccTTHHHHHHccccEEEEc################### DISOP:02AL 1-7, 155-159| PSIPRED ccccccccccccccccHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccccEEEEEcccccccccEEEEEEEccccHHHHHHHHccccEEEEEEcccccc //