[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86685.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  269/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:243 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   12->72 1bibA PDBj 5e-04 16.4 %
:RPS:SCOP  1->64 1j5yA1  a.4.5.1 * 2e-15 30.2 %
:HMM:SCOP  1->64 1j5yA1 a.4.5.1 * 7e-11 31.7 %
:RPS:PFM   9->58 PF08279 * HTH_11 2e-04 42.9 %
:HMM:PFM   6->60 PF08279 * HTH_11 5.9e-21 43.6 55/55  
:BLT:SWISS 3->224 YOBV_BACSU 3e-07 25.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86685.2 GT:GENE AAK86685.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(874407..875138) GB:FROM 874407 GB:TO 875138 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86685.2 GB:DB_XREF GI:159139820 LENGTH 243 SQ:AASEQ MRKASRLFEIIQILRLARRPVTAQTIADMLEVTARSVYRDIAALQTMRVPIEGERGVGYILRPGFNLPPLMFSIEETEAIVLALAMVDRSGDAELRQAAKKVSDKIAASLPEPLSKTLSANALHAWGSIAPAPAGIDLATVRRAVRDEERLDLCYSDESGVETQRRIRPIAVIYYSETVNIVAWCELRHAIRNFRSDRVLDCAATGSFFKMEGEKLRRLWMSGWQSGQPGGELGRPISGVTLP GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 3->224|YOBV_BACSU|3e-07|25.0|212/313| RP:PDB:NREP 1 RP:PDB:REP 12->72|1bibA|5e-04|16.4|61/294| RP:PFM:NREP 1 RP:PFM:REP 9->58|PF08279|2e-04|42.9|49/52|HTH_11| HM:PFM:NREP 1 HM:PFM:REP 6->60|PF08279|5.9e-21|43.6|55/55|HTH_11| RP:SCP:NREP 1 RP:SCP:REP 1->64|1j5yA1|2e-15|30.2|63/65|a.4.5.1| HM:SCP:REP 1->64|1j5yA1|7e-11|31.7|63/65|a.4.5.1|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 375 OP:NHOMOORG 270 OP:PATTERN -------------------------------------------------------------------- -1--1--------------------2------12121223-2-----1--1------2---11-2-1-111---------1---------------1----1---22111----------------------1-------1---4--------------------------------------1-1--------222222331322112-1331-231---3---32222134-----------------1------------------------------------11------------------------1------------112222121122-2------2----1----11---11---------1--11111-----2-121---1----11111111111-11-11-11132-33312323242211111-21----244-------------1----------------------------------11-----11111111111111211111113111111--111--2111-111--1-----2------------1----------------------11-11-111-----------------------------12---1111--11111---111111--111------1-------111---------------------------------12112-1-1-111-111-111111-------------------------------1211--3-4---------------11111-1----11111-111---1--11---------------------1-11111-1---------------------------1--------------------------------------1- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 61 STR:RPRED 25.1 SQ:SECSTR ###########HHHHHTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHH########################################################################################################################################################################### DISOP:02AL 1-1,95-96| PSIPRED ccHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccccEEEEcccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEEEEEEEEccEEEEEEEEcccccEEEEEEEEEEccEEccccccccHHHHHHHHHHHHccccccccccccccccccc //