[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86686.2
DDBJ      :             RhtB family transporter
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  177/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:214 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->157 PF01810 * LysE 1e-10 35.0 %
:HMM:PFM   16->200 PF01810 * LysE 2.7e-25 26.2 183/192  
:BLT:SWISS 21->177 Y4757_PSEAE 2e-14 31.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86686.2 GT:GENE AAK86686.2 GT:PRODUCT RhtB family transporter GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 875273..875917 GB:FROM 875273 GB:TO 875917 GB:DIRECTION + GB:PRODUCT RhtB family transporter GB:PROTEIN_ID AAK86686.2 GB:DB_XREF GI:159139821 LENGTH 214 SQ:AASEQ MNYAENLWLFFLLLFGIIILPGMDMMFVLASALTGGRKTGLSAASGMSAGGMVHSLYGAAGVGLLATWLPSLFLPLLVGGAACMVWIGFGLMRSAITVNGDEAQASTSARKAFWRAVITCLSNPKAYLFMMAVYPQFIKPGFGPIWMQGLVMGAMVAVTQFAVYGTVALTADRSRAWLISSPAATIFIGRAAGFLLIAAALLTFWEAFSWSMGE GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 21->177|Y4757_PSEAE|2e-14|31.2|157/216| TM:NTM 6 TM:REGION 10->32| TM:REGION 46->68| TM:REGION 74->96| TM:REGION 114->136| TM:REGION 148->169| TM:REGION 182->204| SEG 7->20|lwlfflllfgiiil| SEG 42->52|saasgmsaggm| SEG 191->202|aagflliaaall| RP:PFM:NREP 1 RP:PFM:REP 21->157|PF01810|1e-10|35.0|137/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 16->200|PF01810|2.7e-25|26.2|183/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 305 OP:NHOMOORG 178 OP:PATTERN -------------------------------------------------------------------- ----2--------------------------------21--------1------------------11-1---------------------------------------1------------------1---------------1--------------------------------------------------------1--------1--------23----------2------------------------------------------------------------------------------------------------------------------------------------------------222--------2--------------------1------1---5--533132543322-------11--12-1---------------------------------------------------1---14665643222233352222215212132--332--1----1-1---3--1-1-----------11--11-21----1-----1---1-1-----1------------------------1------11---1-1-------111----1-11-----------------242-1211-11111-1-1111111111111111111-1-2311--2--------------1-1-------1---------------------1-----21---------------11121--11---1111---1-11111-------------12232222221222----------1-1------------------------------------------------------------ ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 93-111,213-215| PSIPRED cccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //