[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86689.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->60 PF09489 * CbtB 7e-24 49.0 51/55  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86689.2 GT:GENE AAK86689.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 878016..878198 GB:FROM 878016 GB:TO 878198 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86689.2 GB:DB_XREF GI:159139823 LENGTH 60 SQ:AASEQ MSTNLNTANSAVSVKTASVAQSLTAIVLGLFVVGFVGFSHVEAVHNAAHDTRHANAFPCH GT:EXON 1|1-60:0| TM:NTM 1 TM:REGION 17->39| SEG 27->38|vlglfvvgfvgf| HM:PFM:NREP 1 HM:PFM:REP 10->60|PF09489|7e-24|49.0|51/55|CbtB| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,12-12,54-55| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //