[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86690.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:236 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->232 PF09490 * CbtA 5e-27 42.3 %
:HMM:PFM   3->232 PF09490 * CbtA 1.5e-84 56.5 223/226  
:BLT:SWISS 85->163 UHPT_CHLPN 7e-04 34.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86690.2 GT:GENE AAK86690.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 878210..878920 GB:FROM 878210 GB:TO 878920 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86690.2 GB:DB_XREF GI:159139824 LENGTH 236 SQ:AASEQ MSFFRNIVFTAILVGILGGFAVSAMQAFGTTPLILQAETFESAGEAPHSHDAPAPGAAVPAHEHNDEAWAPADGFERTAYTVAANVLTAIGYALVLTGLISLRGTNTGWREGLLWGVAGFAAVMLAPMIGLPPELPGSPAAALEARQIWWLATVAATAGGIALIAFRREPWAVLLALVLIVAPHVIGAPLPPEGEHALAPLPLERQFIVAATITSFVFWALIGTLSAFFLKRFQQA GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 85->163|UHPT_CHLPN|7e-04|34.2|79/455| TM:NTM 6 TM:REGION 7->29| TM:REGION 82->104| TM:REGION 115->137| TM:REGION 145->166| TM:REGION 172->194| TM:REGION 208->230| SEG 172->182|avllalvliva| RP:PFM:NREP 1 RP:PFM:REP 4->232|PF09490|5e-27|42.3|222/228|CbtA| HM:PFM:NREP 1 HM:PFM:REP 3->232|PF09490|1.5e-84|56.5|223/226|CbtA| OP:NHOMO 47 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111111-11111-1--1---11---1111-------1-1-----11-------------------------------------------------------1---------------------------------------11-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----------------------------11111111--111-111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,44-53,236-237| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //