[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86691.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->77 PF07369 * DUF1488 2.6e-05 27.0 74/83  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86691.1 GT:GENE AAK86691.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 878925..879239 GB:FROM 878925 GB:TO 879239 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86691.1 GB:DB_XREF GI:15155877 LENGTH 104 SQ:AASEQ MQDAAEWSEELDALRFAVPGHGAPCAVHRLAFKAVLGATPEREAALACFHEHEAAFIAAALSKIKRANLPAGRSLHLNSRDIRRAISGEGEEPAARVCRLLDRG GT:EXON 1|1-104:0| SEG 47->60|acfheheaafiaaa| HM:PFM:NREP 1 HM:PFM:REP 3->77|PF07369|2.6e-05|27.0|74/83|DUF1488| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 86-88| PSIPRED cccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEcccHHHHHHHHccccccHHHHHHHHHHcc //