Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86695.2
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86695.2 GT:GENE AAK86695.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 881070..881483 GB:FROM 881070 GB:TO 881483 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86695.2 GB:DB_XREF GI:159139825 LENGTH 137 SQ:AASEQ MAFSRPIQWPQAASLTPSAWASAFRTCDSRLAISGWAEATTSALAPVEAEALLFMSQRAAARLAEAPASGATAVATLPATEMARWAARVSSCKASVVDWLSRLCAGAMPRTGEAKLMLLVAAIVVMTVNPLVLMEHF GT:EXON 1|1-137:0| TM:NTM 1 TM:REGION 114->134| SEG 59->71|aaarlaeapasga| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccHHHHHHcc //