[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86700.1
DDBJ      :             ABC transporter, membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  390/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:302 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   125->234 3dhwA PDBj 5e-04 25.5 %
:RPS:PDB   195->233 3dhwA PDBj 2e-12 30.8 %
:RPS:SCOP  142->293 2r6gG1  f.58.1.1 * 7e-08 15.8 %
:RPS:PFM   126->230 PF00528 * BPD_transp_1 1e-05 37.1 %
:HMM:PFM   125->282 PF00528 * BPD_transp_1 7.5e-31 32.3 158/185  
:BLT:SWISS 29->234 PROW_ECOLI 8e-37 44.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86700.1 GT:GENE AAK86700.1 GT:PRODUCT ABC transporter, membrane spanning protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(884715..885623) GB:FROM 884715 GB:TO 885623 GB:DIRECTION - GB:PRODUCT ABC transporter, membrane spanning protein GB:PROTEIN_ID AAK86700.1 GB:DB_XREF GI:15155886 LENGTH 302 SQ:AASEQ MALCNYLPDLLCKFPAIDNSTMRVARKTIDDGFRDIVRNYGDAIDVIVHPLQLFLNASERLFIETPWIITMLVILAIVHLAGRSFKITGGTAISLFMIGAVGLWRDAMTTLSIVTIATLIAIVIGLPLGILMGRSERLQRLINPVLDVMQTLPSFVYLIPVVVIFGIGKVPGLIAVVIYAIPPVIRLTSLGIRLVDREVLEAADAFGSSNGQKLFNVQLPLALPTIMTGINQTIMMALAMVVVASMVGVGGLGKNVLQAINNQFFTVGFLNGFALVAIAIMFDRASQAFGKRLQKYREVSHG GT:EXON 1|1-302:0| BL:SWS:NREP 1 BL:SWS:REP 29->234|PROW_ECOLI|8e-37|44.1|204/354| TM:NTM 7 TM:REGION 61->83| TM:REGION 86->108| TM:REGION 111->133| TM:REGION 142->164| TM:REGION 172->194| TM:REGION 231->253| TM:REGION 264->286| SEG 109->124|ttlsivtiatliaivi| SEG 174->185|iavviyaippvi| SEG 235->253|mmalamvvvasmvgvgglg| BL:PDB:NREP 1 BL:PDB:REP 125->234|3dhwA|5e-04|25.5|110/203| RP:PDB:NREP 1 RP:PDB:REP 195->233|3dhwA|2e-12|30.8|39/203| RP:PFM:NREP 1 RP:PFM:REP 126->230|PF00528|1e-05|37.1|105/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 125->282|PF00528|7.5e-31|32.3|158/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 142->293|2r6gG1|7e-08|15.8|152/284|f.58.1.1| OP:NHOMO 651 OP:NHOMOORG 401 OP:PATTERN --------------------------------------11111--11--1111--------------- -----1--------------------------------1------11-1--1--------21-1-212221-----------2-----1111-2--------------1------------------------------21---1---1--------1---1--------1-1-----1--------------22222211212121113-2212221---141132233321211111111111111133312--1231--------331-111-1112222111-33-----------22222222222221--------1-11-1-------1-11-221111111-------2211-113-11--1-1--------------------1---2-22222222222-11-112-1231157744455464311---11632223-4--------1---1--1-----------------------------2-----122111111132111-11121111-1212-1------2--1111-2-12-1-----1---------------11112111-2111----------1---1------------------------------11----1---3-1111-11------1--11----11-------1211-212222222222-2222222212222222221222111111111111111111111222122221-111111111111---------------221-----1-----------------11--3333333414432-322-----------112-----22311---1-11-----------------11111111------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 36.4 SQ:SECSTR ############################################################################################################################TGGGGGGGGccccHHHHHHHHHHHHHHccHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHH#################################################################### DISOP:02AL 297-302| PSIPRED ccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //