[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86701.1
DDBJ      :             ABC transporter, substrate binding protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  76/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:336 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   149->332 2b4mA PDBj 2e-07 25.0 %
:RPS:PDB   156->323 3chgA PDBj 6e-11 17.9 %
:RPS:SCOP  33->331 1r9lA  c.94.1.1 * 6e-43 20.8 %
:HMM:SCOP  24->332 1r9lA_ c.94.1.1 * 3e-71 30.4 %
:RPS:PFM   31->272 PF04069 * OpuAC 7e-18 30.3 %
:HMM:PFM   32->314 PF04069 * OpuAC 1.7e-64 31.9 254/257  
:BLT:SWISS 149->332 OPUAC_BACSU 5e-07 25.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86701.1 GT:GENE AAK86701.1 GT:PRODUCT ABC transporter, substrate binding protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(885865..886875) GB:FROM 885865 GB:TO 886875 GB:DIRECTION - GB:PRODUCT ABC transporter, substrate binding protein GB:PROTEIN_ID AAK86701.1 GB:DB_XREF GI:15155887 LENGTH 336 SQ:AASEQ MKKLLASTILVTGFITAAGAANSANAAETCGNITIAEMNWASAGVAAYVDKFIMENGYDCTVNVISGDTTPTFTSMNEKGQPDMAPEMWVNTLGTPYEEAVKKGNLIQEVKILSEGGVEGWWIPKYLADEHPDIKTVEDALKHPELFPAPEDASKGAVFGCPPGWGCQPTTANLFKARKADEKGFALIDTGSAAGLDGSISNAYEKKQGWLGYYWSPTAILGKYDMVKLDDGVALDREAYDTCIAKPDCADPKPNAYPVAEVFTVVTKDFAEKAGPSIDYIRKRQWDNATVAGVLAWMDDNQGTNEDGAEYFLENHEDIWTKWVSPEVAEKIKASM GT:EXON 1|1-336:0| BL:SWS:NREP 1 BL:SWS:REP 149->332|OPUAC_BACSU|5e-07|25.0|160/293| SEG 17->27|aagaansanaa| BL:PDB:NREP 1 BL:PDB:REP 149->332|2b4mA|2e-07|25.0|160/264| RP:PDB:NREP 1 RP:PDB:REP 156->323|3chgA|6e-11|17.9|145/258| RP:PFM:NREP 1 RP:PFM:REP 31->272|PF04069|7e-18|30.3|228/256|OpuAC| HM:PFM:NREP 1 HM:PFM:REP 32->314|PF04069|1.7e-64|31.9|254/257|OpuAC| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF04069|IPR007210| GO:PFM GO:0005488|"GO:binding"|PF04069|IPR007210| GO:PFM GO:0006810|"GO:transport"|PF04069|IPR007210| RP:SCP:NREP 1 RP:SCP:REP 33->331|1r9lA|6e-43|20.8|289/310|c.94.1.1| HM:SCP:REP 24->332|1r9lA_|3e-71|30.4|299/309|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 126 OP:NHOMOORG 78 OP:PATTERN ----------------------------------------------------1--------------- ------------------------------------------------------------21-----111--------------------1-----------------------------------------------------------------------------------------------------------------------------------1---------1--------------------------------------------------------------------------------------------------------------------------------1-1------------------------------------11-11-11-------1--1-1-233122522445-------311111-1---------------------------------------------1-----12222-----1--------1------1----------------------------------------------1--1----1------------------------------------------------------1---1-------1------1--11--------------------------------------------------------------------------1--------------------------------------------------------------11--22222344-211--232-------------1-----1-1--------------------------------------------------------------------------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 298 STR:RPRED 88.7 SQ:SECSTR ##############################cEEEE####EEEGGGHHHHHHHHHHHHHccEEEEEEEcHHHHHHHHHHTccccEEEcccHHHHHHHHHHHHHTTcccGGGcEEEEEEcEEEEEETTcccccccccTTccHHHHHTTccHHHHHTTccEEcccTTcHHHHHHHHHHHHTTcTTccEGGEEcccHHHHHHHHHHHHHTTccccEEEEcccTHHHHccEEEcccTTcTTccEEEEEEEETTHccTTcTTcccEEEEEEEETTHHHHcHHHHHHHTTccccHHHHHHHHHHHHHTcccTTTHHHHHHHccHHHHHHTcccccccEE#### PSIPRED cHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHcccEEEEccccccccEEEEEEcHHHHHHccccccHHHHHccHHHHccccccccccEEcccccccHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHccccEEEEEEcccHHHcccccEEccccccccccccccccccccccccccccccHHHHHEEEcHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHcccHHHHHHHHHcc //