[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86721.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.12
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   71->125 2hcbD PDBj 3e-04 38.9 %
:RPS:SCOP  71->129 1l8qA1  a.4.12.2 * 2e-11 32.8 %
:HMM:SCOP  61->132 1l8qA1 a.4.12.2 * 1.2e-12 33.3 %
:RPS:PFM   71->107 PF08299 * Bac_DnaA_C 1e-05 51.4 %
:HMM:PFM   46->105 PF08299 * Bac_DnaA_C 2.2e-10 33.9 59/70  
:BLT:SWISS 71->123 DNAA_CLOPH 5e-07 45.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86721.2 GT:GENE AAK86721.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 906032..906454 GB:FROM 906032 GB:TO 906454 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86721.2 GB:DB_XREF GI:159139835 LENGTH 140 SQ:AASEQ MPSDTLLLSAAARPRMQAVDRPFRHWPPVAGREEIARLCRLVRQLTGEMVQLTGDRFAARRDRRRIECHIRQIAMYVCHVALGIPMSDIGPCFGRDRTTVGHACQVVEDRRDEPAFDEFVAVLERLVVGIFSVMKGGRDE GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 71->123|DNAA_CLOPH|5e-07|45.3|53/453| SEG 55->65|drfaarrdrrr| BL:PDB:NREP 1 BL:PDB:REP 71->125|2hcbD|3e-04|38.9|54/320| RP:PFM:NREP 1 RP:PFM:REP 71->107|PF08299|1e-05|51.4|37/70|Bac_DnaA_C| HM:PFM:NREP 1 HM:PFM:REP 46->105|PF08299|2.2e-10|33.9|59/70|Bac_DnaA_C| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF08299|IPR013159| GO:PFM GO:0006270|"GO:DNA-dependent DNA replication initiation"|PF08299|IPR013159| GO:PFM GO:0006275|"GO:regulation of DNA replication"|PF08299|IPR013159| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF08299|IPR013159| RP:SCP:NREP 1 RP:SCP:REP 71->129|1l8qA1|2e-11|32.8|58/108|a.4.12.2| HM:SCP:REP 61->132|1l8qA1|1.2e-12|33.3|72/0|a.4.12.2|1/1|TrpR-like| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------1--1---11111111111---------1-1--111--------11111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 38.6 SQ:SECSTR ######################################################################HHHHHHHHHHTccccHHHHHTTcccccHHHHHHHHHHHTTc#cccHHHHHHHHHH############### DISOP:02AL 1-2,57-66,138-141| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccc //